Comparing GFF2390 FitnessBrowser__Marino:GFF2390 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
O33341 Putative glutamine amidotransferase Rv2859c; EC 2.4.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
37% identity, 72% coverage: 57:232/244 of query aligns to 124:298/308 of O33341
3fijA Crystal structure of a uncharacterized protein lin1909
31% identity, 73% coverage: 53:231/244 of query aligns to 38:222/224 of 3fijA
7d50B Spua mutant - h221n with glutamyl-thioester (see paper)
35% identity, 72% coverage: 57:231/244 of query aligns to 64:250/255 of 7d50B
7d53A Spua mutant - h221n with glu (see paper)
35% identity, 72% coverage: 57:231/244 of query aligns to 58:244/249 of 7d53A
7d4rB Spua native structure (see paper)
37% identity, 57% coverage: 94:231/244 of query aligns to 65:212/215 of 7d4rB
P76038 Gamma-glutamyl-gamma-aminobutyrate hydrolase PuuD; Gamma-Glu-GABA hydrolase; EC 3.5.1.94 from Escherichia coli (strain K12) (see paper)
30% identity, 73% coverage: 54:232/244 of query aligns to 59:247/254 of P76038
6vtvB Crystal structure of puud gamma-glutamyl-gamma-aminobutyrate hydrolase from e. Coli
30% identity, 73% coverage: 54:232/244 of query aligns to 57:245/252 of 6vtvB
>GFF2390 FitnessBrowser__Marino:GFF2390
MSEESKEQELEVPGLTIGISGPARKSLAHRLISLGLRLHGARTHYIRPGSRVAVPMLDGL
VLSGGTHVHPERYGQEPQVTANYDRKRDKTDQSLLEQAEAIGIPVLGICRGAQFINVFHG
GSLCQNVTPLRVNTRHRPLLLPLQTVRLVTHSRLEQAMRSPVIGANRIHSQAIKRLGRNL
RVTAVDNDLFVQAIESTGRQWLTGIQWHPEYLLYHGGHRRIFGQFVDAARRYKLARLEPD
SDDA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory