Comparing GFF2391 FitnessBrowser__Phaeo:GFF2391 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q51742 Ornithine carbamoyltransferase, anabolic; OTCase; EC 2.1.3.3 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see 3 papers)
47% identity, 96% coverage: 12:308/308 of query aligns to 18:312/315 of Q51742
Sites not aligning to the query:
Q81M99 Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 from Bacillus anthracis
48% identity, 84% coverage: 43:302/308 of query aligns to 44:305/316 of Q81M99
4nf2A Crystal structure of anabolic ornithine carbamoyltransferase from bacillus anthracis in complex with carbamoyl phosphate and l- norvaline
47% identity, 84% coverage: 43:302/308 of query aligns to 40:301/307 of 4nf2A
8qeuA Crystal structure of ornithine transcarbamylase from arabidopsis thaliana (atotc) in complex with ornithine (see paper)
45% identity, 100% coverage: 1:307/308 of query aligns to 1:303/304 of 8qeuA
8qevA Crystal structure of ornithine transcarbamylase from arabidopsis thaliana (atotc) in complex with carbamoyl phosphate (see paper)
44% identity, 100% coverage: 1:307/308 of query aligns to 1:296/297 of 8qevA
7nouA Crystal structure of mycobacterium tuberculosis argf in complex with (3,5-dichlorophenyl)boronic acid.
46% identity, 89% coverage: 34:306/308 of query aligns to 28:305/308 of 7nouA
7nosA Crystal structure of mycobacterium tuberculosis argf in complex with 4-bromo-6-(trifluoromethyl)-1h-benzo[d]imidazole.
46% identity, 89% coverage: 34:306/308 of query aligns to 28:305/308 of 7nosA
7norA Crystal structure of mycobacterium tuberculosis argf in complex with 2-fluoro-4-hydroxybenzonitrile.
46% identity, 89% coverage: 34:306/308 of query aligns to 28:305/308 of 7norA
7nnyA Crystal structure of mycobacterium tuberculosis argf in complex with naphthalen-1-ol.
46% identity, 89% coverage: 34:306/308 of query aligns to 28:305/308 of 7nnyA
7nnwA Crystal structure of mycobacterium tuberculosis argf in complex with methyl 4-hydroxy-3-iodobenzoate.
46% identity, 89% coverage: 34:306/308 of query aligns to 28:305/308 of 7nnwA
7nnvA Crystal structure of mycobacterium tuberculosis argf in complex with carbamoyl phosphate.
46% identity, 89% coverage: 34:306/308 of query aligns to 28:305/308 of 7nnvA
P9WIT9 Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
46% identity, 89% coverage: 34:306/308 of query aligns to 27:304/307 of P9WIT9
2i6uA Crystal structure of ornithine carbamoyltransferase complexed with carbamoyl phosphate and l-norvaline from mycobacterium tuberculosis (rv1656) at 2.2 a (see paper)
46% identity, 89% coverage: 34:306/308 of query aligns to 27:304/307 of 2i6uA
7nnzB Crystal structure of mycobacterium tuberculosis argf in complex with 5-methyl-4-phenylthiazol-2-amine.
45% identity, 89% coverage: 34:306/308 of query aligns to 27:294/297 of 7nnzB
7np0A Crystal structure of mycobacterium tuberculosis argf in complex with (4-nitrophenyl)boronic acid.
46% identity, 89% coverage: 34:306/308 of query aligns to 28:302/305 of 7np0A
7novA Crystal structure of mycobacterium tuberculosis argf in complex with (4-methyl-3-nitrophenyl)boronic acid.
45% identity, 89% coverage: 34:306/308 of query aligns to 28:299/302 of 7novA
1duvG Crystal structure of e. Coli ornithine transcarbamoylase complexed with ndelta-l-ornithine-diaminophosphinyl-n-sulphonic acid (psorn) (see paper)
39% identity, 97% coverage: 3:302/308 of query aligns to 7:327/333 of 1duvG
P04391 Ornithine carbamoyltransferase subunit I; OTCase-1; EC 2.1.3.3 from Escherichia coli (strain K12) (see 7 papers)
39% identity, 97% coverage: 3:302/308 of query aligns to 8:328/334 of P04391
Sites not aligning to the query:
2otcA Ornithine transcarbamoylase complexed with n-(phosphonacetyl)-l- ornithine (see paper)
38% identity, 97% coverage: 3:302/308 of query aligns to 7:327/333 of 2otcA
P00481 Ornithine transcarbamylase, mitochondrial; OTCase; Ornithine carbamoyltransferase, mitochondrial; EC 2.1.3.3 from Rattus norvegicus (Rat) (see 2 papers)
39% identity, 86% coverage: 39:302/308 of query aligns to 72:338/354 of P00481
Sites not aligning to the query:
>GFF2391 FitnessBrowser__Phaeo:GFF2391
MNHFLDIHKTDATDLRAIIDQASATKQARLGRPKAAPDDELPLKDRMVALIFEKPSTRTR
VSFDVGVRQMGGQTMVLSGNDMQLGHGETIADTARVLSRYVDMIMIRTFDETVLTEMAEY
ASVPVINGLTDRTHPCQIMADVLTYEEHRGPIKGKKVVWCGDGNNVCASFLHAAAQFGFD
LTFTGPAQLDPEPEFIGLARNAGSQVIIERDAAKAVEGADLVVADTWVSMHDSQSSKERR
HNMLRGYQVNDALMAHAKPDALFMHCLPAHREEEVTSAVMDGPQSVIFDEAENRLHAQKA
IMRYCLGA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory