SitesBLAST
Comparing GFF2403 FitnessBrowser__Phaeo:GFF2403 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P26276 Phosphomannomutase/phosphoglucomutase; PMM / PGM; EC 5.4.2.2; EC 5.4.2.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 10 papers)
33% identity, 93% coverage: 14:477/498 of query aligns to 2:444/463 of P26276
- R15 (= R27) mutation to A: KM halves, decreases processivity as dissociation of G1,6P intermediate increases 25-fold.
- Y17 (= Y29) binding ; binding
- R20 (= R32) mutation to A: No phosphoglucomutase activity.
- S108 (= S121) binding via phosphate group; modified: Phosphoserine; mutation S->A,V: About 5% activity, still subject to substrate inhibition and requires G1,6P as an activator; phosphorylation occurs at a different site.; mutation to C: KM for G1P unchanged, kcat decreases 24-fold; G1,6P stimulates reaction by 2-3 orders of magnitude. No stable protein phosphorylation detected, altered ligation of metal residue.
- N110 (= N123) mutation to A: KM halves, decreases processivity as dissociation of G1,6P intermediate increases 30-fold.
- D242 (= D258) binding
- D244 (= D260) binding
- D246 (= D262) binding
- R247 (= R263) mutation to A: Small reduction in KM, small increase in dissociation of G1,6P intermediate.
- R262 (≠ K278) mutation to A: Increases KM 2-fold, decreases kcat 9-fold for G1P. Alters flexibility of the hinge region.
- K285 (= K301) binding
- H308 (= H326) binding ; binding
- E325 (= E343) mutation to A: Reduces KM and Vmax approximately 2-fold.
- EMSGH 325:329 (≠ EKSGH 343:347) binding ; binding
- H329 (= H347) mutation to A: No phosphoglucomutase activity using G1P as substrate, protein is less easily phosphorylated, no significant change in structure.
- P368 (= P388) mutation to G: Increases KM 2-fold, decreases kcat 6-fold for G1P. Alters flexibility of the hinge region, structure is less compact.
- R421 (= R453) mutation to C: Loss of phosphomannomutase activity, very low phosphoglucomutase activity.
- RASNT 421:425 (≠ RASSN 453:457) binding ; binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Q02E40 Phosphomannomutase/phosphoglucomutase; PMM / PGM; EC 5.4.2.2; EC 5.4.2.8 from Pseudomonas aeruginosa (strain UCBPP-PA14) (see paper)
33% identity, 93% coverage: 14:477/498 of query aligns to 2:444/463 of Q02E40
- S108 (= S121) active site, Non-phosphorylated intermediate; modified: Phosphoserine
1pcjX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
32% identity, 92% coverage: 19:477/498 of query aligns to 2:439/458 of 1pcjX
- active site: R15 (= R32), S103 (= S121), H104 (= H122), K113 (= K131), D237 (= D258), D239 (= D260), D241 (= D262), R242 (= R263), H324 (= H347), D335 (= D359)
- binding 1-O-phosphono-alpha-D-mannopyranose: Y12 (= Y29), S103 (= S121), T301 (= T324), G302 (= G325), E320 (= E343), S322 (= S345), H324 (= H347), R416 (= R453), S418 (= S455), N419 (≠ S456), T420 (≠ N457)
- binding zinc ion: S103 (= S121), D237 (= D258), D239 (= D260), D241 (= D262)
1k2yX Crystal structure of phosphomannomutase/phosphoglucomutase s108a mutant from p. Aeruginosa (see paper)
32% identity, 93% coverage: 17:477/498 of query aligns to 1:440/459 of 1k2yX
2h5aX Complex of the enzyme pmm/pgm with xylose 1-phosphate (see paper)
33% identity, 91% coverage: 26:477/498 of query aligns to 6:436/455 of 2h5aX
- active site: H101 (= H122), D234 (= D258), D236 (= D260), D238 (= D262), R239 (= R263), D332 (= D359)
- binding 1-O-phosphono-alpha-D-xylopyranose: Y9 (= Y29), T298 (= T324), G299 (= G325), H300 (= H326), E317 (= E343), S319 (= S345), H321 (= H347), R413 (= R453), S415 (= S455), N416 (≠ S456), T417 (≠ N457)
- binding zinc ion: S100 (= S121), D234 (= D258), D236 (= D260), D238 (= D262)
2h4lX Complex of pmm/pgm with ribose 1-phosphate (see paper)
33% identity, 91% coverage: 26:477/498 of query aligns to 6:436/455 of 2h4lX
- active site: H101 (= H122), D234 (= D258), D236 (= D260), D238 (= D262), R239 (= R263), D332 (= D359)
- binding 1-O-phosphono-alpha-D-ribofuranose: Y9 (= Y29), R12 (= R32), S100 (= S121), T298 (= T324), E317 (= E343), R413 (= R453), S415 (= S455), N416 (≠ S456), T417 (≠ N457)
- binding zinc ion: S100 (= S121), D234 (= D258), D236 (= D260), D238 (= D262)
2fkfA Phosphomannomutase/phosphoglucomutase from pseudomonas aeruginosa with alpha-d-glucose 1,6-bisphosphate bound (see paper)
33% identity, 91% coverage: 26:477/498 of query aligns to 6:436/455 of 2fkfA
- active site: R12 (= R32), S100 (= S121), H101 (= H122), K110 (= K131), D234 (= D258), D236 (= D260), D238 (= D262), R239 (= R263), H321 (= H347), D332 (= D359)
- binding 1,6-di-O-phosphono-alpha-D-glucopyranose: R7 (= R27), H101 (= H122), S319 (= S345), R413 (= R453), S415 (= S455), N416 (≠ S456), T417 (≠ N457)
- binding zinc ion: S100 (= S121), D234 (= D258), D236 (= D260), D238 (= D262)
1pcmX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
33% identity, 91% coverage: 26:477/498 of query aligns to 6:436/455 of 1pcmX
- active site: R12 (= R32), S100 (= S121), H101 (= H122), K110 (= K131), D234 (= D258), D236 (= D260), D238 (= D262), R239 (= R263), H321 (= H347), D332 (= D359)
- binding 6-O-phosphono-alpha-D-mannopyranose: Y9 (= Y29), S100 (= S121), T298 (= T324), G299 (= G325), H300 (= H326), E317 (= E343), S319 (= S345), H321 (= H347), R413 (= R453), S415 (= S455)
- binding zinc ion: S100 (= S121), D234 (= D258), D236 (= D260), D238 (= D262)
1p5gX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
33% identity, 91% coverage: 26:477/498 of query aligns to 6:436/455 of 1p5gX
- active site: R12 (= R32), S100 (= S121), H101 (= H122), K110 (= K131), D234 (= D258), D236 (= D260), D238 (= D262), R239 (= R263), H321 (= H347), D332 (= D359)
- binding 6-O-phosphono-alpha-D-glucopyranose: Y9 (= Y29), S100 (= S121), K277 (= K301), G299 (= G325), H300 (= H326), E317 (= E343), S319 (= S345), H321 (= H347), R413 (= R453), S415 (= S455), N416 (≠ S456), T417 (≠ N457)
- binding zinc ion: S100 (= S121), D234 (= D258), D236 (= D260), D238 (= D262)
1p5dX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
33% identity, 91% coverage: 26:477/498 of query aligns to 6:436/455 of 1p5dX
- active site: R12 (= R32), S100 (= S121), H101 (= H122), K110 (= K131), D234 (= D258), D236 (= D260), D238 (= D262), R239 (= R263), H321 (= H347), D332 (= D359)
- binding 1-O-phosphono-alpha-D-glucopyranose: Y9 (= Y29), S100 (= S121), R239 (= R263), T298 (= T324), G299 (= G325), H300 (= H326), E317 (= E343), S319 (= S345), H321 (= H347), R413 (= R453), S415 (= S455), T417 (≠ N457)
- binding zinc ion: S100 (= S121), D234 (= D258), D236 (= D260), D238 (= D262)
4il8A Crystal structure of an h329a mutant of p. Aeruginosa pmm/pgm (see paper)
32% identity, 93% coverage: 17:477/498 of query aligns to 1:440/459 of 4il8A
- active site: R16 (= R32), S104 (= S121), H105 (= H122), K114 (= K131), D238 (= D258), D240 (= D260), D242 (= D262), R243 (= R263), A325 (≠ H347), D336 (= D359)
- binding magnesium ion: S104 (= S121), D238 (= D258), D240 (= D260), D242 (= D262)
3rsmA Crystal structure of s108c mutant of pmm/pgm (see paper)
33% identity, 87% coverage: 47:477/498 of query aligns to 14:417/436 of 3rsmA
- active site: C87 (≠ S121), K91 (≠ T128), D215 (= D258), D217 (= D260), D219 (= D262), R220 (= R263), H302 (= H347), D313 (= D359)
- binding phosphate ion: C87 (≠ S121), D215 (= D258), D217 (= D260), D219 (= D262), R220 (= R263)
- binding zinc ion: D215 (= D258), D217 (= D260), D219 (= D262)
3uw2A X-ray crystal structure of phosphoglucomutase/phosphomannomutase family protein (bth_i1489)from burkholderia thailandensis (see paper)
32% identity, 92% coverage: 20:475/498 of query aligns to 1:438/458 of 3uw2A
- active site: R13 (= R32), S109 (= S121), H110 (= H122), K119 (= K131), D243 (= D258), D245 (= D260), D247 (= D262), R248 (= R263), H330 (= H347)
- binding zinc ion: D243 (= D258), D245 (= D260), D247 (= D262)
1wqaA Crystal structure of pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with mg2+
29% identity, 90% coverage: 26:471/498 of query aligns to 5:437/455 of 1wqaA
- active site: R11 (= R32), S101 (= S121), H102 (= H122), K111 (= K131), D243 (= D258), D245 (= D260), D247 (= D262), R248 (= R263), G330 (≠ H347), R340 (≠ Y358)
- binding magnesium ion: S101 (= S121), D243 (= D258), D245 (= D260), D247 (= D262)
6nqhA Xanthomonas citri dephospho-pgm in complex with xylose-1-phosphate
29% identity, 73% coverage: 21:386/498 of query aligns to 1:360/448 of 6nqhA
- active site: R12 (= R32), S97 (= S121), H98 (= H122), K107 (= K131), D237 (= D258), D239 (= D260), D241 (= D262), R242 (= R263), H324 (= H347)
- binding magnesium ion: D237 (= D258), D239 (= D260), D241 (= D262)
- binding 1-O-phosphono-alpha-D-xylopyranose: R12 (= R32), S97 (= S121), H98 (= H122), K107 (= K131), D239 (= D260), R242 (= R263), R280 (≠ K301), S301 (≠ T324), G302 (= G325), E320 (= E343), S322 (= S345), H324 (= H347)
Sites not aligning to the query:
6np8A Xanthomonas citri phospho-pgm in complex with mannose-6-phosphate (see paper)
29% identity, 73% coverage: 21:386/498 of query aligns to 1:360/448 of 6np8A
- active site: R12 (= R32), S97 (= S121), H98 (= H122), K107 (= K131), D237 (= D258), D239 (= D260), D241 (= D262), R242 (= R263), H324 (= H347)
- binding calcium ion: S97 (= S121), D237 (= D258), D239 (= D260), D241 (= D262)
- binding 6-O-phosphono-alpha-D-mannopyranose: Y9 (= Y29), R280 (≠ K301), G302 (= G325), H303 (= H326), E320 (= E343), S322 (= S345), H324 (= H347)
Sites not aligning to the query:
6nolA Xanthomonas citri dephospho-pgm in complex with mannose-1-phosphate (see paper)
29% identity, 73% coverage: 21:386/498 of query aligns to 1:360/448 of 6nolA
- active site: R12 (= R32), S97 (= S121), H98 (= H122), K107 (= K131), D237 (= D258), D239 (= D260), D241 (= D262), R242 (= R263), H324 (= H347)
- binding 1-O-phosphono-alpha-D-mannopyranose: G302 (= G325), E320 (= E343), S322 (= S345), H324 (= H347)
- binding magnesium ion: S97 (= S121), D237 (= D258), D239 (= D260), D241 (= D262)
Sites not aligning to the query:
6nnpA Xanthomonas citri dephospho-pgm in complex with glucose-6-phosphate (see paper)
29% identity, 73% coverage: 21:386/498 of query aligns to 1:360/448 of 6nnpA
- active site: R12 (= R32), S97 (= S121), H98 (= H122), K107 (= K131), D237 (= D258), D239 (= D260), D241 (= D262), R242 (= R263), H324 (= H347)
- binding 6-O-phosphono-alpha-D-glucopyranose: R280 (≠ K301), G302 (= G325), H303 (= H326), E320 (= E343), H324 (= H347)
- binding magnesium ion: S97 (= S121), D237 (= D258), D239 (= D260), D241 (= D262)
Sites not aligning to the query:
6nn2A Xanthomonas citri pgm apo-phospho (see paper)
29% identity, 73% coverage: 21:386/498 of query aligns to 1:360/448 of 6nn2A
- active site: R12 (= R32), S97 (= S121), H98 (= H122), K107 (= K131), D237 (= D258), D239 (= D260), D241 (= D262), R242 (= R263), H324 (= H347)
- binding calcium ion: S97 (= S121), D237 (= D258), D239 (= D260), D241 (= D262)
6n1eA Crystal structure of x. Citri phosphoglucomutase in complex with 1- methyl-glucose 6-phosphate (see paper)
29% identity, 73% coverage: 21:386/498 of query aligns to 1:360/448 of 6n1eA
Sites not aligning to the query:
Query Sequence
>GFF2403 FitnessBrowser__Phaeo:GFF2403
MTKPIPEVRPNTWSFLRDPMITPTGFREYDARWKYPEEINLPGMTALGLGLGTQMHKRGI
PPVIAVANDYRDYSVAIKHALIIGLMQAGIEVRDIGPALSPMAYFAQFHLDVPAVAMVTA
SHNPNGWTGVKMGFERPLTHGPDEMGELRDIVLNGEGVARPGGSYQFVDGVKEAYLDDLV
GDFKMSRPLKVVCATGNGTASAFAPELFERMGVEVVDSHNALDYTFPHYNPNPEAMEMLH
DMSASVKASGADMALGFDGDGDRCGVVDDEGEEIFADKVGVIMARDLSKLYPNSTFVADV
KSTGLFASDPELKANGVTADYWKTGHSHMKRRVKEIGALAGFEKSGHYFLAEPVGRGYDC
GMRVAVEICKLMDRNPDKSMSDLRKALPKTWATPTMSPYCADTEKYTVLERLVAKLVAKA
EAGETLADRPIKEVVTVNGARVILDNGSWGLVRASSNTPNLVVVCESSESEAELREIFAE
IDAVIRTEPLVGEYDQTF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory