Comparing GFF2426 FitnessBrowser__WCS417:GFF2426 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7mh7A Crystal structure of NAD kinase from pseudomonas aeruginosa pao1
88% identity, 98% coverage: 2:291/296 of query aligns to 1:290/290 of 7mh7A
P0A7B3 NAD kinase; ATP-dependent NAD kinase; EC 2.7.1.23 from Escherichia coli (strain K12) (see paper)
46% identity, 98% coverage: 3:291/296 of query aligns to 4:291/292 of P0A7B3
P9WHV7 NAD kinase; ATP-dependent NAD kinase; Poly(P)-dependent NAD kinase; PPNK; EC 2.7.1.23 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 3 papers)
32% identity, 89% coverage: 1:262/296 of query aligns to 1:274/307 of P9WHV7
1y3iA Crystal structure of mycobacterium tuberculosis NAD kinase-NAD complex (see paper)
36% identity, 67% coverage: 70:268/296 of query aligns to 12:209/231 of 1y3iA
O13863 Uncharacterized kinase C1B1.02c; EC 2.7.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
30% identity, 90% coverage: 28:292/296 of query aligns to 235:516/537 of O13863
Sites not aligning to the query:
3afoA Crystal structure of yeast nadh kinase complexed with nadh
30% identity, 81% coverage: 49:287/296 of query aligns to 97:342/360 of 3afoA
1z0zA Crystal structure of a NAD kinase from archaeoglobus fulgidus in complex with NAD (see paper)
34% identity, 64% coverage: 61:248/296 of query aligns to 38:212/249 of 1z0zA
1z0sA Crystal structure of an NAD kinase from archaeoglobus fulgidus in complex with atp (see paper)
34% identity, 64% coverage: 61:248/296 of query aligns to 38:212/249 of 1z0sA
Sites not aligning to the query:
1suwA Crystal structure of a NAD kinase from archaeoglobus fulgidus in complex with its substrate and product: insights into the catalysis of NAD kinase (see paper)
34% identity, 64% coverage: 61:248/296 of query aligns to 38:212/249 of 1suwA
O30297 NAD kinase; ATP-dependent NAD kinase; EC 2.7.1.23 from Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) (see paper)
34% identity, 64% coverage: 61:248/296 of query aligns to 38:212/249 of O30297
Q9P7K3 Uncharacterized kinase C24B10.02c; EC 2.7.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
26% identity, 77% coverage: 62:290/296 of query aligns to 174:409/449 of Q9P7K3
Sites not aligning to the query:
5ejiA Crystal structure of NAD kinase w78f mutant from listeria monocytogenes in complex with NADP/mn++/ppi
32% identity, 50% coverage: 64:210/296 of query aligns to 37:180/260 of 5ejiA
6rc0A Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an adenine derivative (see paper)
31% identity, 50% coverage: 64:210/296 of query aligns to 37:181/261 of 6rc0A
6rbpA Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an adenine derivative (see paper)
32% identity, 50% coverage: 64:210/296 of query aligns to 37:180/260 of 6rbpA
6rc1A Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an adenine derivative (see paper)
32% identity, 50% coverage: 64:210/296 of query aligns to 37:180/259 of 6rc1A
3v8nA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with 8-bromo-5'-amino-5'-deoxyadenosine, reacted with a citrate molecule in n site (see paper)
32% identity, 50% coverage: 64:210/296 of query aligns to 37:180/257 of 3v8nA
6rbzA Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an adenine derivative (see paper)
30% identity, 50% coverage: 64:210/296 of query aligns to 37:182/262 of 6rbzA
6rg8A Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an inhibitor (see paper)
31% identity, 50% coverage: 64:210/296 of query aligns to 37:181/260 of 6rg8A
Sites not aligning to the query:
6rbyA Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an adenine derivative (see paper)
31% identity, 50% coverage: 64:210/296 of query aligns to 37:181/260 of 6rbyA
8a9vA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
31% identity, 50% coverage: 64:210/296 of query aligns to 37:181/261 of 8a9vA
Sites not aligning to the query:
>GFF2426 FitnessBrowser__WCS417:GFF2426
MEQFRNIGIIGRLGSTQVLDTVRRLKKFLLERHLHVILEDTIAEILPGHGLQTSSRKMLG
EVCDMVIVVGGDGSLLGAARALARHNVPVLGINRGSLGFLTDIRPDDLEVEVAKVLDGHY
LVENRFLLQAEVRRHGEAIGQGDALNDVVLHPGKSTRMIEFELYIDGQFVCSQKADGLIV
ATPTGSTAYALSAGGPIMHPKLDAIVIVPMYPHMLSSRPIVVDGNSELKIVVSKDMQIYP
QVSCDGQNHFTCAPGDTITVSKKAQKLRLIHPLDHNYYEVCRTKLGWGSRLGGGGD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory