SitesBLAST
Comparing GFF2430 FitnessBrowser__psRCH2:GFF2430 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
27% identity, 95% coverage: 19:406/408 of query aligns to 15:421/425 of O59010
- S65 (≠ L63) mutation to V: Strongly decreased chloride conductance.
- R276 (= R263) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (= RSS 263:265) binding
- M311 (= M298) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (≠ A301) binding
- V355 (= V342) binding
- D394 (= D379) binding
- M395 (≠ S380) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (≠ E382) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N386) binding
- D405 (= D390) mutation to N: Strongly decreased affinity for aspartate.
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
29% identity, 95% coverage: 19:407/408 of query aligns to 11:420/425 of 6zgbA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
29% identity, 95% coverage: 19:407/408 of query aligns to 10:419/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (= L181), G195 (≠ V185), R282 (≠ Q274)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (= R263), S272 (= S264), S273 (= S265), M307 (= M298), T310 (≠ A301), G353 (= G344), A354 (≠ G345), R394 (≠ E382), T395 (= T383)
Sites not aligning to the query:
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
29% identity, 95% coverage: 19:407/408 of query aligns to 6:411/416 of 6r7rA
- binding d-aspartic acid: R263 (= R263), S265 (= S265), M299 (= M298), T302 (≠ A301), T340 (≠ A339), G342 (= G341), V343 (= V342), G347 (≠ S346), D383 (= D379), R386 (≠ E382), T387 (= T383), N390 (= N386)
- binding decyl-beta-d-maltopyranoside: H23 (vs. gap), V212 (≠ L210), A216 (≠ R215)
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
29% identity, 95% coverage: 19:407/408 of query aligns to 13:422/427 of 5e9sA
- binding aspartic acid: R274 (= R263), S275 (= S264), S276 (= S265), T313 (≠ A301), G353 (= G341), V354 (= V342), A357 (≠ G345), G358 (≠ S346), D394 (= D379), R397 (≠ E382), T398 (= T383)
- binding decyl-beta-d-maltopyranoside: L194 (= L181), G198 (≠ V185), Y202 (≠ F189)
- binding sodium ion: Y87 (≠ A87), T90 (= T90), S91 (= S94), S276 (= S265), G305 (= G293), A306 (= A294), T307 (= T295), N309 (= N297), N309 (= N297), M310 (= M298), D311 (≠ G299), S348 (≠ A336), I349 (≠ C337), G350 (= G338), T351 (≠ A339), N401 (= N386), V402 (≠ S387), D405 (= D390)
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
29% identity, 95% coverage: 19:407/408 of query aligns to 13:422/426 of 6xwnB
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
27% identity, 94% coverage: 19:402/408 of query aligns to 7:409/409 of 6bavA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
28% identity, 92% coverage: 19:395/408 of query aligns to 7:402/408 of 6bauA
- binding cysteine: S270 (= S265), M303 (= M298), T306 (≠ A301), A345 (≠ S340), G346 (= G341), V347 (= V342), G351 (≠ S346), D386 (= D379), C389 (≠ E382), T390 (= T383), N393 (= N386)
2nwwA Crystal structure of gltph in complex with tboa (see paper)
28% identity, 92% coverage: 19:395/408 of query aligns to 6:401/407 of 2nwwA
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
27% identity, 92% coverage: 19:395/408 of query aligns to 15:410/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ L44), F46 (≠ L44), P75 (≠ R73), L91 (≠ G89), F95 (≠ S94), L130 (≠ V126), I133 (≠ T129), I159 (= I155), Y167 (≠ H163), K196 (≠ L181), G200 (≠ V185), I207 (≠ L192), F210 (= F195), L250 (≠ I240), I262 (≠ V248), M269 (≠ G256), T334 (≠ D321), V335 (≠ I322), G336 (≠ A323), T340 (≠ L327), L343 (= L330), M399 (≠ A384)
- binding aspartic acid: S277 (= S264), S278 (= S265), T314 (≠ A301), G354 (= G341), A358 (≠ G345), G359 (≠ S346), D394 (= D379), R397 (≠ E382), T398 (= T383)
- binding sodium ion: Y89 (≠ A87), T92 (= T90), S93 (= S92), G306 (= G293), T308 (= T295), N310 (= N297), N310 (= N297), M311 (= M298), D312 (≠ G299), S349 (≠ A336), I350 (≠ C337), T352 (≠ A339), N401 (= N386), V402 (≠ S387), D405 (= D390)
Sites not aligning to the query:
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
27% identity, 92% coverage: 19:395/408 of query aligns to 12:407/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (≠ S67), V83 (≠ L84), I157 (≠ G156), Y164 (≠ H163), K193 (≠ L181), T305 (= T295), I306 (= I296), I347 (≠ C337)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (= I20), M199 (≠ I187), S275 (= S265), T311 (≠ A301), G356 (≠ S346), L384 (≠ I374), D391 (= D379), R394 (≠ E382)
Sites not aligning to the query:
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
29% identity, 78% coverage: 19:336/408 of query aligns to 7:344/396 of 6bmiA
Sites not aligning to the query:
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
25% identity, 93% coverage: 23:401/408 of query aligns to 33:400/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ R73), G89 (= G74), G92 (≠ H78), A95 (≠ P81), V96 (≠ I82), Y99 (≠ L85), M163 (≠ I155), F167 (= F159), F293 (≠ V288), V297 (≠ L292)
- binding aspartic acid: S268 (= S264), S269 (= S265), T306 (≠ A301), G346 (= G341), I347 (≠ V342), A350 (≠ G345), G351 (≠ S346), D380 (= D379), R383 (≠ E382), T384 (= T383)
P56564 Excitatory amino acid transporter 1; Glial high affinity glutamate transporter; High-affinity neuronal glutamate transporter; GluT-1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Mus musculus (Mouse) (see paper)
27% identity, 65% coverage: 138:401/408 of query aligns to 233:496/543 of P56564
Sites not aligning to the query:
- 206 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 216 modified: carbohydrate, N-linked (GlcNAc...) asparagine
P43003 Excitatory amino acid transporter 1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Homo sapiens (Human) (see 3 papers)
27% identity, 65% coverage: 138:401/408 of query aligns to 233:496/542 of P43003
- S363 (≠ R263) mutation to R: Loss of electrogenic glutamate transport. Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with M-477.
- SSS 363:365 (≠ RSS 263:265) binding
- T396 (= T295) binding
- T402 (≠ A301) binding
- IPQAG 443:447 (≠ VAGGS 342:346) binding
- D476 (= D379) binding
- R477 (≠ S380) mutation to M: Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with R-363.
- N483 (= N386) binding
Sites not aligning to the query:
- 523 Y→F: No effect on activity.
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
25% identity, 93% coverage: 23:401/408 of query aligns to 25:386/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (vs. gap), S80 (≠ R73), G81 (= G74), G84 (≠ H78), Y91 (= Y86), M156 (≠ I155), F160 (= F159), F286 (≠ V288), V290 (≠ L292)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (≠ L59), I148 (≠ F147), S262 (= S265), S263 (≠ A266), A292 (= A294), T293 (= T295), M296 (= M298), T299 (≠ A301), G329 (= G338), A336 (≠ G345), G337 (≠ S346), D366 (= D379), R369 (≠ E382), N373 (= N386)
7vr7A Inward-facing structure of human eaat2 in the way213613-bound state (see paper)
26% identity, 91% coverage: 20:390/408 of query aligns to 11:388/402 of 7vr7A
- binding (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en: S57 (= S67), L58 (= L68), L65 (≠ Q75), V339 (≠ C337), G340 (= G338), S343 (≠ G341), I344 (≠ V342)
- binding cholesterol: W188 (≠ R188), I227 (≠ F226), F250 (= F249), W257 (≠ G256), M379 (≠ A381), S382 (≠ A384)
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S266 (= S265), M300 (= M298), T303 (≠ A301), Y306 (≠ T304), G348 (≠ S346), L349 (= L347), M352 (≠ I350), I366 (≠ A364), L369 (≠ V367), V370 (= V368), D373 (≠ G371), D377 (= D379), R380 (≠ E382), T381 (= T383), N384 (= N386)
Sites not aligning to the query:
6mpbB Cryo-em structure of the human neutral amino acid transporter asct2 (see paper)
28% identity, 63% coverage: 138:392/408 of query aligns to 179:435/446 of 6mpbB
7bcsA Asct2 in the presence of the inhibitor lc-bpe (position "down") in the outward-open conformation. (see paper)
28% identity, 63% coverage: 138:392/408 of query aligns to 175:431/442 of 7bcsA
7bcqA Asct2 in the presence of the inhibitor lc-bpe (position "up") in the outward-open conformation. (see paper)
28% identity, 63% coverage: 138:392/408 of query aligns to 175:431/442 of 7bcqA
Sites not aligning to the query:
Query Sequence
>GFF2430 FitnessBrowser__psRCH2:GFF2430
MSDMPRVIRFISRTSLVAQIVVGLVAGALLALFLPAAAKSVALLGDLFVQALKAVAPILV
FVLVTSSLANHKRGQPTHIRPIILLYALGTLSASAVAVLASFMFPTTLTLVSGAADVTPP
SGVGAVLQTLLFNVADNPVRALLNGNFIGILAWAIGLGFAFRHAQDSTRRLIGDLSDGVT
LIVKVVIRFAPLGVFGLVAGTLADSGFDVLLGYLRLLLVLVGAMLFMALVMNPLIVFWQI
RRNPYPLVFTCLRESGITAFFTRSSAANIPVNMQLCQRLGLHKDTYSVSIPLGATINMGG
AAITITVLTLAAVNTLGIQVDIATAVLLSLLAAVCACGASGVAGGSLLLIPLACSLFGIS
NDLAMQVVAVGFIIGVVQDSAETALNSSTDVLFTAASCIAHGDIAEAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory