SitesBLAST
Comparing GFF2446 FitnessBrowser__Phaeo:GFF2446 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5vt3B High resolution structure of thioredoxin-disulfide reductase from vibrio vulnificus cmcp6 in complex with NADP and fad
59% identity, 99% coverage: 1:309/313 of query aligns to 3:315/319 of 5vt3B
- active site: C138 (= C136), C141 (= C139), D142 (= D140)
- binding flavin-adenine dinucleotide: G15 (= G13), S16 (= S14), G17 (= G15), P18 (= P16), A19 (= A17), T38 (≠ Q36), G39 (= G37), Q41 (≠ E39), G44 (= G42), Q45 (= Q43), L46 (= L44), T49 (= T47), N54 (= N52), H86 (≠ I83), I87 (= I84), S114 (≠ A112), T115 (= T113), G116 (= G114), E162 (= E160), H247 (= H244), G287 (= G281), D288 (= D282), R295 (= R289), Q296 (= Q290), A297 (= A291), S300 (= S294)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L122 (= L120), G156 (= G154), G157 (= G155), N158 (= N156), T159 (= T157), H178 (= H176), R179 (= R177), R180 (= R178), R184 (= R182), I245 (= I242), G246 (= G243), R295 (= R289), Q296 (= Q290)
P0A9P4 Thioredoxin reductase; TRXR; EC 1.8.1.9 from Escherichia coli (strain K12) (see 2 papers)
60% identity, 99% coverage: 1:309/313 of query aligns to 1:314/321 of P0A9P4
- M1 (= M1) modified: Initiator methionine, Removed
- 36:43 (vs. 36:43, 63% identical) binding
- C136 (= C136) modified: Disulfide link with 139, Redox-active
- C139 (= C139) modified: Disulfide link with 136, Redox-active
- 287:296 (vs. 282:291, 70% identical) binding
4jnqA Crystal structure of a thioredoxin reductase from brucella melitensis
59% identity, 99% coverage: 5:313/313 of query aligns to 5:315/315 of 4jnqA
- active site: C137 (= C136), C140 (= C139), D141 (= D140)
- binding dihydroflavine-adenine dinucleotide: I12 (= I12), G13 (= G13), S14 (= S14), G15 (= G15), P16 (= P16), A17 (= A17), A36 (≠ Q36), G37 (= G37), Q39 (≠ E39), G42 (= G42), Q43 (= Q43), L44 (= L44), N52 (= N52), I85 (= I84), A113 (= A112), T114 (= T113), C140 (= C139), G283 (= G281), D284 (= D282), R291 (= R289), Q292 (= Q290), A293 (= A291)
1f6mA Crystal structure of a complex between thioredoxin reductase, thioredoxin, and the NADP+ analog, aadp+ (see paper)
60% identity, 98% coverage: 4:309/313 of query aligns to 3:313/320 of 1f6mA
- active site: S135 (≠ C136), C138 (= C139), D139 (= D140)
- binding 3-aminopyridine-adenine dinucleotide phosphate: L119 (= L120), G153 (= G154), G154 (= G155), N155 (= N156), T156 (= T157), E159 (= E160), H175 (= H176), R176 (= R177), R177 (= R178), R181 (= R182), I243 (= I242), G244 (= G243), H245 (= H244), R293 (= R289), Q294 (= Q290)
- binding flavin-adenine dinucleotide: G12 (= G13), S13 (= S14), G14 (= G15), P15 (= P16), A16 (= A17), T35 (≠ Q36), G36 (= G37), E38 (= E39), G41 (= G42), Q42 (= Q43), L43 (= L44), T46 (= T47), V49 (= V50), N51 (= N52), H83 (≠ I83), I84 (= I84), A111 (= A112), T112 (= T113), G113 (= G114), H245 (= H244), G285 (= G281), D286 (= D282), R293 (= R289), Q294 (= Q290), A295 (= A291), S298 (= S294)
1tdfA Crystal structure of escherichia coli thioredoxin reductase refined at 2 angstrom resolution: implications for a large conformational change during catalysis (see paper)
60% identity, 98% coverage: 4:309/313 of query aligns to 3:313/316 of 1tdfA
- active site: C135 (= C136), S138 (≠ C139), D139 (= D140)
- binding flavin-adenine dinucleotide: G12 (= G13), S13 (= S14), G14 (= G15), P15 (= P16), A16 (= A17), T35 (≠ Q36), G36 (= G37), E38 (= E39), G41 (= G42), Q42 (= Q43), L43 (= L44), T46 (= T47), V49 (= V50), N51 (= N52), H83 (≠ I83), I84 (= I84), A111 (= A112), T112 (= T113), S138 (≠ C139), G285 (= G281), D286 (= D282), R293 (= R289), Q294 (= Q290), A295 (= A291), S298 (= S294)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L119 (= L120), I151 (= I152), T156 (= T157), E159 (= E160), H175 (= H176), R176 (= R177), R181 (= R182), E183 (= E184), I243 (= I242), G244 (= G243), H290 (= H286), R293 (= R289)
5u63B Crystal structure of putative thioredoxin reductase from haemophilus influenzae
57% identity, 100% coverage: 1:312/313 of query aligns to 4:319/319 of 5u63B
- active site: C139 (= C136), C142 (= C139), D143 (= D140)
- binding flavin-adenine dinucleotide: G16 (= G13), S17 (= S14), G18 (= G15), P19 (= P16), A20 (= A17), T39 (≠ Q36), G40 (= G37), Q42 (≠ E39), G45 (= G42), Q46 (= Q43), L47 (= L44), T50 (= T47), N55 (= N52), H87 (≠ I83), I88 (= I84), A115 (= A112), T116 (= T113), G117 (= G114), H248 (= H244), G288 (= G281), D289 (= D282), R296 (= R289), Q297 (= Q290), A298 (= A291), S301 (= S294)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R121 (≠ K118), G157 (= G154), H179 (= H176), R180 (= R177), R181 (= R178), I246 (= I242), G247 (= G243), H248 (= H244), R296 (= R289)
8ccmA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with compound 2-06
52% identity, 97% coverage: 9:312/313 of query aligns to 5:305/305 of 8ccmA
- binding flavin-adenine dinucleotide: I8 (= I12), G9 (= G13), S10 (= S14), G11 (= G15), P12 (= P16), A13 (= A17), E32 (≠ Q36), G33 (= G37), Q35 (≠ E39), G38 (= G42), A39 (≠ Q43), L40 (= L44), T43 (= T47), N48 (= N52), D80 (= D86), V81 (≠ L87), M109 (≠ T113), G110 (= G114), T131 (≠ A135), C135 (= C139), G274 (= G281), D275 (= D282), R282 (= R289), Q283 (= Q290), A284 (= A291), A287 (≠ S294)
- binding ~{N}6-(4-aminophenyl)-1,2-benzothiazole-3,6-diamine: R114 (≠ K118), H115 (≠ W119), L116 (= L120), R173 (= R177), E200 (≠ Q204), I201 (≠ L205), I235 (= I242)
8cclA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry a09
52% identity, 97% coverage: 9:312/313 of query aligns to 5:305/305 of 8cclA
- binding flavin-adenine dinucleotide: I8 (= I12), G9 (= G13), S10 (= S14), G11 (= G15), P12 (= P16), A13 (= A17), E32 (≠ Q36), G33 (= G37), Q35 (≠ E39), G38 (= G42), A39 (≠ Q43), L40 (= L44), T43 (= T47), N48 (= N52), D80 (= D86), V81 (≠ L87), M109 (≠ T113), G110 (= G114), T131 (≠ A135), C135 (= C139), G274 (= G281), D275 (= D282), R282 (= R289), Q283 (= Q290), A284 (= A291), A287 (≠ S294)
- binding [1,2]thiazolo[5,4-b]pyridin-3-amine: L116 (= L120), R173 (= R177), E200 (≠ Q204), I201 (≠ L205)
8cckA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry h07
52% identity, 97% coverage: 9:312/313 of query aligns to 5:305/305 of 8cckA
- binding flavin-adenine dinucleotide: G9 (= G13), S10 (= S14), G11 (= G15), P12 (= P16), A13 (= A17), E32 (≠ Q36), G33 (= G37), Q35 (≠ E39), G38 (= G42), A39 (≠ Q43), L40 (= L44), T43 (= T47), N48 (= N52), D80 (= D86), V81 (≠ L87), M109 (≠ T113), G110 (= G114), T131 (≠ A135), C135 (= C139), G274 (= G281), D275 (= D282), R282 (= R289), Q283 (= Q290), A284 (= A291), A287 (≠ S294)
- binding ~{N}-(4-hydroxyphenyl)-2-pyrazol-1-yl-ethanamide: R114 (≠ K118), H115 (≠ W119), L116 (= L120), V148 (≠ I152), R173 (= R177), E200 (≠ Q204), I201 (≠ L205)
8ccjA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with NADPH
52% identity, 97% coverage: 9:312/313 of query aligns to 5:305/305 of 8ccjA
- binding flavin-adenine dinucleotide: I8 (= I12), G9 (= G13), S10 (= S14), G11 (= G15), P12 (= P16), A13 (= A17), E32 (≠ Q36), G33 (= G37), Q35 (≠ E39), G38 (= G42), A39 (≠ Q43), L40 (= L44), T43 (= T47), N48 (= N52), D80 (= D86), V81 (≠ L87), M109 (≠ T113), G110 (= G114), T131 (≠ A135), C135 (= C139), G274 (= G281), D275 (= D282), R282 (= R289), Q283 (= Q290), A284 (= A291), A287 (≠ S294)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G150 (= G154), G151 (= G155), D152 (≠ N156), S153 (≠ T157), E156 (= E160), H172 (= H176), R173 (= R177), R174 (= R178), R178 (= R182), I235 (= I242)
5uthA Crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad
52% identity, 97% coverage: 9:312/313 of query aligns to 6:306/306 of 5uthA
- active site: C133 (= C136), C136 (= C139), D137 (= D140)
- binding flavin-adenine dinucleotide: I9 (= I12), G10 (= G13), S11 (= S14), G12 (= G15), P13 (= P16), A14 (= A17), F32 (≠ V35), E33 (≠ Q36), G34 (= G37), Q36 (≠ E39), G39 (= G42), A40 (≠ Q43), L41 (= L44), N49 (= N52), D81 (= D86), V82 (≠ L87), M110 (≠ T113), G111 (= G114), C136 (= C139), G275 (= G281), D276 (= D282), R283 (= R289), Q284 (= Q290), A285 (= A291), A288 (≠ S294)
3d8xA Crystal structure of saccharomyces cerevisiae ndpph dependent thioredoxin reductase 1 (see paper)
49% identity, 98% coverage: 6:313/313 of query aligns to 2:318/318 of 3d8xA
- active site: C141 (= C136), C144 (= C139), D145 (= D140)
- binding flavin-adenine dinucleotide: I8 (= I12), S10 (= S14), G11 (= G15), P12 (= P16), A13 (= A17), Y31 (≠ V35), G33 (= G37), A36 (vs. gap), I39 (= I38), G43 (= G42), Q44 (= Q43), I51 (≠ V50), N53 (= N52), T85 (≠ I83), V86 (≠ I84), T118 (= T113), G119 (= G114), C144 (= C139), G286 (= G281), D287 (= D282), R294 (= R289), Q295 (= Q290), A296 (= A291), S299 (= S294)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: M125 (≠ L120), G160 (= G153), S164 (≠ T157), R184 (= R177), K185 (≠ R178), R189 (= R182), I247 (= I242)
3itjB Crystal structure of saccharomyces cerevisiae thioredoxin reductase 1 (trr1) (see paper)
49% identity, 98% coverage: 6:313/313 of query aligns to 3:319/319 of 3itjB
- active site: C142 (= C136), C145 (= C139), D146 (= D140)
- binding flavin-adenine dinucleotide: I9 (= I12), G10 (= G13), S11 (= S14), G12 (= G15), P13 (= P16), A14 (= A17), Y32 (≠ V35), E33 (≠ Q36), G34 (= G37), A37 (vs. gap), I40 (= I38), A41 (≠ E39), G44 (= G42), Q45 (= Q43), T49 (= T47), I52 (≠ V50), N54 (= N52), T86 (≠ I83), V87 (≠ I84), T119 (= T113), G120 (= G114), W135 (≠ K129), C145 (= C139), G287 (= G281), D288 (= D282), R295 (= R289), Q296 (= Q290), A297 (= A291), S300 (= S294)
P29509 Thioredoxin reductase 1; TR; TrxR; Thioredoxin peroxidase 1; TPx; Thioredoxin-dependent peroxide reductase 1; EC 1.8.1.9 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 3 papers)
49% identity, 98% coverage: 6:313/313 of query aligns to 3:319/319 of P29509
- SGPA 11:14 (= SGPA 14:17) binding
- IA 40:41 (≠ IE 38:39) binding
- Q45 (= Q43) binding
- N54 (= N52) binding
- V87 (≠ I84) binding
- C142 (= C136) modified: Disulfide link with 145, Redox-active
- C145 (= C139) binding ; modified: Disulfide link with 142, Redox-active
- D288 (= D282) binding
- RQA 295:297 (= RQA 289:291) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
5w4cA Crystal structure of thioredoxin reductase from cryptococcus neoformans in complex with fad (fo conformation)
48% identity, 100% coverage: 1:313/313 of query aligns to 12:334/356 of 5w4cA
- binding calcium ion: E99 (≠ D82), E116 (≠ V95), E118 (≠ K97)
- binding flavin-adenine dinucleotide: I23 (= I12), G24 (= G13), S25 (= S14), P27 (= P16), G28 (≠ A17), Y46 (≠ V35), G48 (= G37), A51 (vs. gap), F54 (vs. gap), G58 (= G42), Q59 (= Q43), L60 (= L44), T63 (= T47), N68 (= N52), V101 (≠ I84), T134 (= T113), G135 (= G114), G302 (= G281), D303 (= D282), R310 (= R289), Q311 (= Q290), A312 (= A291), S315 (= S294)
Sites not aligning to the query:
P9WHH1 Thioredoxin reductase; TR; TRXR; EC 1.8.1.9 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
51% identity, 97% coverage: 9:312/313 of query aligns to 17:318/335 of P9WHH1
- SGPA 22:25 (= SGPA 14:17) binding
- Y32 (= Y24) modified: Phosphotyrosine; by PtkA; mutation to A: Significantly reduces phosphorylation.
- 44:51 (vs. 36:43, 38% identical) binding
- N60 (= N52) binding
- V93 (≠ L87) binding
- C145 (= C136) modified: Disulfide link with 148, Redox-active
- C148 (= C139) modified: Disulfide link with 145, Redox-active
- S166 (≠ T157) binding
- H185 (= H176) binding
- R191 (= R182) binding
- I248 (= I242) binding
- Y268 (= Y262) binding
- D288 (= D282) binding
- R295 (= R289) binding
- RQAV 295:298 (= RQAV 289:292) binding
2a87A Crystal structure of m. Tuberculosis thioredoxin reductase (see paper)
51% identity, 97% coverage: 9:312/313 of query aligns to 8:309/313 of 2a87A
- active site: F39 (≠ P40), L43 (= L44), D48 (≠ E49), C136 (= C136), C139 (= C139), D140 (= D140)
- binding flavin-adenine dinucleotide: G12 (= G13), S13 (= S14), G14 (= G15), P15 (= P16), A16 (= A17), F34 (≠ V35), E35 (≠ Q36), G36 (= G37), G40 (= G41), G41 (= G42), A42 (≠ Q43), L43 (= L44), T46 (= T47), V49 (= V50), N51 (= N52), D83 (= D86), V84 (≠ L87), M113 (≠ T113), C139 (= C139), G278 (= G281), D279 (= D282), R286 (= R289), Q287 (= Q290), A288 (= A291), V289 (= V292)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L120 (= L120), G155 (= G155), D156 (≠ N156), S157 (≠ T157), H176 (= H176), R177 (= R177), R178 (= R178), R182 (= R182), I239 (= I242), Y259 (= Y262), R283 (≠ H286), R286 (= R289)
Q92375 Thioredoxin reductase; Caffeine resistance protein 4; EC 1.8.1.9 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
47% identity, 98% coverage: 6:313/313 of query aligns to 3:319/322 of Q92375
- S192 (≠ E184) modified: Phosphoserine
- T278 (= T272) modified: Phosphothreonine
- S279 (= S273) modified: Phosphoserine
6bpyA Aspergillus fumigatus thioredoxin reductase (see paper)
46% identity, 98% coverage: 6:313/313 of query aligns to 2:323/324 of 6bpyA
- binding flavin-adenine dinucleotide: I8 (= I12), G9 (= G13), S10 (= S14), G11 (= G15), P12 (= P16), A13 (= A17), Y31 (≠ V35), E32 (≠ Q36), G33 (= G37), A36 (vs. gap), T38 (vs. gap), A39 (≠ E39), G42 (= G42), Q43 (= Q43), L44 (= L44), T47 (= T47), I50 (≠ V50), N52 (= N52), T84 (≠ I83), I85 (= I84), T120 (= T113), G121 (= G114), C146 (= C139), G291 (= G281), D292 (= D282), R299 (= R289), Q300 (= Q290), A301 (= A291), S304 (= S294)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G163 (= G154), G164 (= G155), S166 (≠ T157), R186 (= R177), R187 (= R178), R191 (= R182), V252 (≠ I242)
Q39243 Thioredoxin reductase 1, mitochondrial; NADPH-dependent thioredoxin reductase 1; NTR1; NADPH-dependent thioredoxin reductase B; AtNTRB; EC 1.8.1.9 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
49% identity, 99% coverage: 3:311/313 of query aligns to 47:366/375 of Q39243
- SGPA 58:61 (= SGPA 14:17) binding
- FE 79:80 (≠ VQ 35:36) binding
- IAPGGQ 87:92 (≠ IEPGGQ 38:43) binding
- N101 (= N52) binding
- V134 (≠ I84) binding
- C189 (= C136) modified: Disulfide link with 192, Redox-active
- C192 (= C139) binding ; modified: Disulfide link with 189, Redox-active
- D337 (= D282) binding
- RQA 344:346 (= RQA 289:291) binding
Sites not aligning to the query:
- 1:37 modified: transit peptide, Mitochondrion
Query Sequence
>GFF2446 FitnessBrowser__Phaeo:GFF2446
MSDTRHTKVLIIGSGPAGYTAGVYASRAMLEPILVQGIEPGGQLTTTTEVENWPGDTEVQ
GPDLMVRMQDHAKAMGCEIIGDIITDLDTTSRPFVAKGDSGTIYTADAVILATGARAKWL
GLPSEEKFKGFGVSACATCDGFFYRGQEIVVIGGGNTAVEEALFLTNFASKVTLIHRRDE
LRAEKILQDRLMKNPKIEPLWFHQLEEVVGTENPLGVEAVRVKNVKTDEITEIPCKGVFV
AIGHAPATELVKDVLETHNGGYVKVTPGTTETSIPGIFAAGDLTDHKYRQAVTSAGMGCM
AALDAERFLAEQE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory