SitesBLAST
Comparing GFF2455 FitnessBrowser__Marino:GFF2455 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2gnaA Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-gal (see paper)
55% identity, 95% coverage: 3:296/310 of query aligns to 27:325/329 of 2gnaA
- binding galactose-uridine-5'-diphosphate: K87 (= K64), S176 (= S153), V177 (= V154), T195 (= T170), M199 (= M174), R201 (= R176), M235 (≠ V210), R254 (= R229), E257 (= E232)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S39 (= S15), R40 (= R16), D41 (= D17), K44 (= K20), D63 (= D40), V64 (= V41), A83 (= A60), A84 (= A61), A85 (= A62), K87 (= K64), L125 (= L102), S126 (= S103), Y137 (= Y114), K141 (= K118), Y167 (= Y144), G168 (= G145), V170 (= V147)
Sites not aligning to the query:
2gn9A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glc (see paper)
55% identity, 95% coverage: 3:296/310 of query aligns to 27:325/329 of 2gn9A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R40 (= R16), D41 (= D17), K44 (= K20), D63 (= D40), V64 (= V41), A83 (= A60), A84 (= A61), A85 (= A62), K87 (= K64), L125 (= L102), S126 (= S103), K141 (= K118), Y167 (= Y144), G168 (= G145), V170 (= V147), R174 (= R151)
- binding uridine-5'-diphosphate-glucose: K87 (= K64), T127 (= T104), K129 (= K106), Y137 (= Y114), N169 (= N146), S176 (= S153), V177 (= V154), P193 (= P168), T195 (= T170), M199 (= M174), R201 (= R176), M235 (≠ V210), R254 (= R229), E257 (= E232)
Sites not aligning to the query:
2gn6A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glcnac (see paper)
55% identity, 95% coverage: 3:296/310 of query aligns to 27:325/329 of 2gn6A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R40 (= R16), D41 (= D17), K44 (= K20), D63 (= D40), V64 (= V41), A84 (= A61), A85 (= A62), K87 (= K64), S126 (= S103), Y137 (= Y114), K141 (= K118), Y167 (= Y144), G168 (= G145), V170 (= V147), S173 (= S150), R174 (= R151)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K64), D128 (= D105), K129 (= K106), N169 (= N146), G175 (= G152), S176 (= S153), V177 (= V154), P193 (= P168), I194 (= I169), M199 (= M174), R201 (= R176), M235 (≠ V210), R254 (= R229), E257 (= E232)
Sites not aligning to the query:
2gn4A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADPH and udp-glcnac (see paper)
55% identity, 95% coverage: 3:296/310 of query aligns to 27:325/329 of 2gn4A
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S39 (= S15), R40 (= R16), D41 (= D17), K44 (= K20), D63 (= D40), V64 (= V41), A83 (= A60), A84 (= A61), A85 (= A62), K87 (= K64), T102 (= T79), L125 (= L102), S126 (= S103), T127 (= T104), Y137 (= Y114), K141 (= K118), Y167 (= Y144), G168 (= G145), V170 (= V147), S173 (= S150), R174 (= R151)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K64), T127 (= T104), D128 (= D105), K129 (= K106), Y137 (= Y114), N169 (= N146), S176 (= S153), V177 (= V154), P193 (= P168), T195 (= T170), M199 (= M174), R201 (= R176), M235 (≠ V210), R254 (= R229), E257 (= E232)
Sites not aligning to the query:
2gn8A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp (see paper)
55% identity, 95% coverage: 3:296/310 of query aligns to 25:323/327 of 2gn8A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S37 (= S15), R38 (= R16), D39 (= D17), K42 (= K20), D61 (= D40), V62 (= V41), A81 (= A60), A82 (= A61), A83 (= A62), K85 (= K64), T100 (= T79), L123 (= L102), S124 (= S103), K139 (= K118), Y165 (= Y144), G166 (= G145), V168 (= V147), S171 (= S150), R172 (= R151)
- binding uridine-5'-diphosphate: K127 (= K106), N167 (= N146), V175 (= V154), P191 (= P168), I192 (= I169), T193 (= T170), M197 (= M174), R199 (= R176), M233 (≠ V210), R252 (= R229)
Sites not aligning to the query:
O25511 UDP-N-acetylglucosamine 4,6-dehydratase (inverting); Pseudaminic acid biosynthesis protein B; UDP-GlcNAc-inverting 4,6-dehydratase; EC 4.2.1.115 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
55% identity, 95% coverage: 3:296/310 of query aligns to 31:329/333 of O25511
Sites not aligning to the query:
6bwcC X-ray structure of pen from bacillus thuringiensis (see paper)
41% identity, 95% coverage: 8:300/310 of query aligns to 30:320/327 of 6bwcC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S37 (= S15), R38 (= R16), S39 (≠ D17), D63 (= D40), I64 (≠ V41), V83 (≠ A60), A84 (= A61), K87 (= K64), T125 (≠ L102), S127 (≠ T104), Y137 (= Y114), K141 (= K118), F167 (≠ Y144), V170 (= V147), S173 (= S150), R174 (= R151)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K64), H88 (≠ I65), S127 (≠ T104), N128 (≠ D105), Y137 (= Y114), N169 (= N146), S176 (= S153), V177 (= V154), L180 (≠ F157), T192 (≠ P168), T194 (= T170), M198 (= M174), R200 (= R176), L234 (≠ V210), E265 (= E232)
Sites not aligning to the query:
4g5hA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with by-product (see paper)
42% identity, 94% coverage: 7:297/310 of query aligns to 37:330/346 of 4g5hA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S45 (= S15), R46 (= R16), D47 (= D17), K50 (= K20), D69 (= D40), V70 (= V41), A89 (= A60), A90 (= A61), A91 (= A62), K93 (= K64), L131 (= L102), T133 (= T104), K147 (= K118), Y173 (= Y144)
- binding [(2R,3R,4R,6R)-3-acetamido-6-methyl-4-oxidanyl-5-oxidanylidene-oxan-2-yl] [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] hydrogen phosphate: Q94 (≠ I65), V95 (= V66), K135 (= K106), N175 (= N146), S182 (= S153), V183 (= V154), L186 (≠ F157), T198 (≠ P168), T200 (= T170), M204 (= M174), V240 (= V210), R263 (= R229), E266 (= E232), Y278 (≠ S244), S313 (≠ G279), Y314 (≠ F280), E315 (≠ V281), Y316 (= Y282), N320 (= N287)
Sites not aligning to the query:
3w1vA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with inihibitor (see paper)
42% identity, 94% coverage: 7:297/310 of query aligns to 37:330/347 of 3w1vA
- binding [(2R,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,4-bis(oxidanyl)oxan-2-yl]methylimino-azanylidene-azanium: K93 (= K64), Q94 (≠ I65), N175 (= N146), S179 (= S150), R180 (= R151), S182 (= S153), V183 (= V154), L186 (≠ F157), T198 (≠ P168), I199 (= I169), T200 (= T170), M204 (= M174), R206 (= R176), V240 (= V210), R263 (= R229), E266 (= E232)
3vvcA Crystal structure of capsular polysaccharide synthesizing enzyme cape , k126e, in apo form (see paper)
43% identity, 94% coverage: 7:297/310 of query aligns to 29:302/318 of 3vvcA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S37 (= S15), R38 (= R16), D39 (= D17), K42 (= K20), D61 (= D40), V62 (= V41), R63 (= R42), A81 (= A60), A82 (= A61), A83 (= A62), K85 (= K64), S124 (= S103), T125 (= T104), K139 (= K118), Y165 (= Y144), G166 (= G145)
Sites not aligning to the query:
4j2oC Crystal structure of NADP-bound wbjb from a. Baumannii community strain d1279779 (see paper)
43% identity, 83% coverage: 9:265/310 of query aligns to 30:290/316 of 4j2oC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S36 (= S15), R37 (= R16), D38 (= D17), K41 (= K20), D60 (= D40), V61 (= V41), A80 (= A60), A81 (= A61), A82 (= A62), K84 (= K64), T99 (= T79), L122 (= L102), K138 (= K118), Y164 (= Y144)
Sites not aligning to the query:
3vvbA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in apo form (see paper)
44% identity, 68% coverage: 7:217/310 of query aligns to 27:213/270 of 3vvbA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S35 (= S15), R36 (= R16), D37 (= D17), K40 (= K20), D59 (= D40), V60 (= V41), A80 (= A61), A81 (= A62), K83 (= K64), L121 (= L102), T123 (= T104), K137 (= K118), Y163 (= Y144), G164 (= G145)
Sites not aligning to the query:
4tqgA Crystal structure of megavirus udp-glcnac 4,6-dehydratase, 5-epimerase mg534 (see paper)
30% identity, 97% coverage: 3:302/310 of query aligns to 22:297/297 of 4tqgA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R36 (= R16), D37 (= D17), D59 (= D40), I60 (≠ V41), A81 (= A60), A82 (= A61), A83 (= A62), K85 (= K64), V128 (≠ L102), Y140 (= Y114), K144 (= K118), Y168 (= Y144), G169 (= G145), V171 (= V147)
Sites not aligning to the query:
5bjuA X-ray structure of the pglf dehydratase from campylobacter jejuni in complex with udp and NAD(h) (see paper)
36% identity, 63% coverage: 55:249/310 of query aligns to 99:297/340 of 5bjuA
- binding nicotinamide-adenine-dinucleotide: A104 (= A60), A105 (= A61), A106 (= A62), K108 (= K64), N123 (≠ T79), I146 (≠ L102), K162 (= K118), F184 (≠ Y144), G185 (= G145), N186 (= N146), V187 (= V147), S190 (= S150), S191 (≠ R151)
- binding uridine-5'-diphosphate: K150 (= K106), N186 (= N146), S193 (= S153), V194 (= V154), T209 (≠ P168), L210 (≠ I169), T211 (= T170), I215 (≠ M174), R217 (= R176), E279 (= E232)
Sites not aligning to the query:
5bjvA X-ray structure of the pglf udp-n-acetylglucosamine 4,6-dehydratase from campylobacterjejuni, d396n/k397a variant in complex with udp-n- acrtylglucosamine (see paper)
35% identity, 63% coverage: 55:249/310 of query aligns to 99:297/339 of 5bjvA
- binding nicotinamide-adenine-dinucleotide: A104 (= A60), A105 (= A61), A106 (= A62), K108 (= K64), N123 (≠ T79), I146 (≠ L102), K162 (= K118), F184 (≠ Y144), G185 (= G145), N186 (= N146), V187 (= V147), S190 (= S150), S191 (≠ R151)
- binding uridine-diphosphate-n-acetylglucosamine: K108 (= K64), H109 (≠ I65), T148 (= T104), G185 (= G145), N186 (= N146), S193 (= S153), V194 (= V154), T209 (≠ P168), L210 (≠ I169), T211 (= T170), I215 (≠ M174), R217 (= R176), R276 (= R229), E279 (= E232)
Sites not aligning to the query:
1r66A Crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with NAD and tyd bound (see paper)
32% identity, 45% coverage: 31:169/310 of query aligns to 54:207/322 of 1r66A
- active site: T127 (= T104), D128 (= D105), E129 (≠ K106), Y151 (= Y114), K155 (= K118)
- binding nicotinamide-adenine-dinucleotide: D63 (= D40), I64 (≠ V41), F83 (≠ A60), A84 (= A61), A85 (= A62), S87 (≠ K64), T102 (= T79), V125 (≠ L102), S126 (= S103), Y151 (= Y114), K155 (= K118), N181 (≠ V147)
- binding thymidine-5'-diphosphate: H88 (≠ I65), E129 (≠ K106), N180 (= N146), K190 (≠ S153), L191 (≠ V154), P206 (= P168)
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 10, 11, 12, 37, 38, 39, 40, 43
- binding thymidine-5'-diphosphate: 208, 215, 250, 274, 277
1r6dA Crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with NAD and dau bound (see paper)
32% identity, 45% coverage: 31:169/310 of query aligns to 54:207/322 of 1r6dA
- active site: T127 (= T104), N128 (≠ D105), Q129 (≠ K106), Y151 (= Y114), K155 (= K118)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S87 (≠ K64), H88 (≠ I65), T127 (= T104), N128 (≠ D105), Q129 (≠ K106), Y151 (= Y114), N180 (= N146), K190 (≠ S153), L191 (≠ V154), P206 (= P168)
- binding nicotinamide-adenine-dinucleotide: D63 (= D40), I64 (≠ V41), F83 (≠ A60), A84 (= A61), A85 (= A62), S87 (≠ K64), T102 (= T79), V125 (≠ L102), S126 (= S103), Y151 (= Y114), K155 (= K118), N181 (≠ V147)
Sites not aligning to the query:
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: 208, 215, 250, 274, 277, 281
- binding nicotinamide-adenine-dinucleotide: 10, 11, 12, 37, 38, 39, 40, 42, 43
3pvzA Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
26% identity, 94% coverage: 5:295/310 of query aligns to 52:316/372 of 3pvzA
- binding nicotinamide-adenine-dinucleotide: D62 (≠ S15), I63 (≠ R16), D92 (≠ F37), I93 (= I38), L114 (≠ A60), S115 (≠ A61), A116 (= A62), K118 (= K64), V158 (≠ L102), D161 (= D105), K174 (= K118), V198 (= V147), S201 (= S150)
Sites not aligning to the query:
3pvzB Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
29% identity, 53% coverage: 5:169/310 of query aligns to 50:224/300 of 3pvzB
- binding nicotinamide-adenine-dinucleotide: D60 (≠ S15), I61 (≠ R16), L89 (≠ F36), D90 (≠ F37), I91 (= I38), L112 (≠ A60), S113 (≠ A61), A114 (= A62), K116 (= K64), D159 (= D105), K172 (= K118), N195 (= N146), V196 (= V147), S199 (= S150)
Sites not aligning to the query:
1sb8A Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4- epimerase complexed with udp-n-acetylgalactosamine (see paper)
25% identity, 69% coverage: 20:233/310 of query aligns to 67:268/341 of 1sb8A
- active site: S142 (≠ T104), S143 (vs. gap), S144 (vs. gap), Y166 (= Y114), K170 (= K118), N204 (≠ K164)
- binding nicotinamide-adenine-dinucleotide: D78 (= D31), I79 (≠ V41), Q98 (≠ A60), A100 (= A62), T117 (= T79), A140 (≠ L102), A141 (≠ S103), Y166 (= Y114), K170 (= K118), Y193 (= Y144), N195 (= N146), V196 (= V147)
- binding uridine-diphosphate-n-acetylgalactosamine: S103 (≠ I65), S142 (≠ T104), S143 (vs. gap), S144 (vs. gap), Y166 (= Y114), N195 (= N146), A209 (≠ I169), V210 (≠ T170), W214 (≠ M174), Y225 (≠ V188), I226 (≠ W189), N227 (≠ H190), R234 (≠ G197)
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 23, 26, 27, 28, 47, 48, 49, 51, 52
- binding uridine-diphosphate-n-acetylgalactosamine: 271, 299, 302, 306
Query Sequence
>GFF2455 FitnessBrowser__Marino:GFF2455
MTLEKYNPKKIIVFSRDEMKQWEMAKLFQGDDRLRFFIGDVRDRDRLYRALDGVDYVVHA
AATKIVPTAEYNPFECVKTNIHGAMNLIDAAIDKGVKGVVALSTDKASSPINLYGATKLA
SDKLFVAGNSYSGGHETKFSVVRYGNVMGSRGSVIPFFMSIKEKGVLPITDPRMTRFMIS
LEQGVELVWHAFEDMVGGEIYVKKIPSMKVTDLAQVVAPDAKQEVVGIRPGEKLHEQMIG
AEDSYFTYEYPEHFKILPNINDWGTCESRIKDGKKVPEGFVYSSDNNSEWMTDKELQAWI
DRHNNEIGKI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory