Comparing GFF2469 PGA1_c25010 low specificity L-threonine aldolase LtaE to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
1v72A Crystal structure of phenylserine aldolase from pseudomonas putida
47% identity, 99% coverage: 1:341/344 of query aligns to 5:338/345 of 1v72A
O50584 Low specificity L-threonine aldolase; Low specificity L-TA; EC 4.1.2.48 from Pseudomonas sp. (strain NCIMB 10558) (see paper)
40% identity, 98% coverage: 2:337/344 of query aligns to 7:333/346 of O50584
5vyeB Crystal structure of l-threonine aldolase from pseudomonas putida
40% identity, 98% coverage: 2:337/344 of query aligns to 5:331/344 of 5vyeB
1jg8D Crystal structure of threonine aldolase (low-specificity)
27% identity, 62% coverage: 5:217/344 of query aligns to 7:213/344 of 1jg8D
Sites not aligning to the query:
1lw5B X-ray structure of l-threonine aldolase (low-specificity) in complex with glycine (see paper)
26% identity, 63% coverage: 1:217/344 of query aligns to 2:212/343 of 1lw5B
Sites not aligning to the query:
1lw4B X-ray structure of l-threonine aldolase (low-specificity) in complex with l-allo-threonine (see paper)
26% identity, 63% coverage: 1:217/344 of query aligns to 2:212/343 of 1lw4B
Sites not aligning to the query:
3wgbD Crystal structure of aeromonas jandaei l-allo-threonine aldolase (see paper)
32% identity, 45% coverage: 51:204/344 of query aligns to 49:195/324 of 3wgbD
Sites not aligning to the query:
O07051 L-allo-threonine aldolase; L-allo-TA; L-allo-threonine acetaldehyde-lyase; EC 4.1.2.49 from Aeromonas jandaei (see paper)
31% identity, 45% coverage: 51:204/344 of query aligns to 51:199/338 of O07051
Sites not aligning to the query:
3wgcB Aeromonas jandaei l-allo-threonine aldolase h128y/s292r double mutant (see paper)
30% identity, 45% coverage: 51:204/344 of query aligns to 50:198/333 of 3wgcB
Sites not aligning to the query:
4rjyA Crystal structure of e. Coli l-threonine aldolase in complex with a non-covalently uncleaved bound l-serine substrate (see paper)
26% identity, 55% coverage: 1:190/344 of query aligns to 2:185/332 of 4rjyA
Sites not aligning to the query:
4lnlA Structure of escherichia coli threonine aldolase in complex with allo- thr (see paper)
26% identity, 55% coverage: 1:190/344 of query aligns to 2:185/332 of 4lnlA
Sites not aligning to the query:
4lnjA Structure of escherichia coli threonine aldolase in unliganded form (see paper)
26% identity, 55% coverage: 1:190/344 of query aligns to 2:185/332 of 4lnjA
Sites not aligning to the query:
4lnmA Structure of escherichia coli threonine aldolase in complex with serine (see paper)
26% identity, 55% coverage: 1:190/344 of query aligns to 2:185/331 of 4lnmA
Sites not aligning to the query:
3wlxA Crystal structure of low-specificity l-threonine aldolase from escherichia coli
26% identity, 55% coverage: 1:190/344 of query aligns to 2:185/331 of 3wlxA
Sites not aligning to the query:
>GFF2469 PGA1_c25010 low specificity L-threonine aldolase LtaE
MHFASDNSGPANPEILTALSAANTGYAMGYGADEEMAKVTSCIREIFEAPQAAVYLVATG
TAANVLALSTLSQPWQTLFCTRQAHINVDECNGPEFYTGGAKLTLVSDADKMTPADLRQA
LEGEENRGVHGPQRGPVSITQVTEFGTVYTLDELRALCDVSKSYGLPVHLDGARFTNALV
SLGCTPAEMTWKAGVDVVSFGGTKNGCMGVEAVIFFDPAEAQEFEYRRKRGAHLFSKHRY
LSAQMLAYLTDDLWLRNASAANAKAARLAAGLRNAGAHFSHDPQANMIFAALPRATHQRL
FDAGAVYHLWDGTLDGAAEEAVTARFVCDWSVGDDQIDAFLALL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory