SitesBLAST
Comparing GFF2483 FitnessBrowser__WCS417:GFF2483 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1tdjA Threonine deaminase (biosynthetic) from e. Coli (see paper)
54% identity, 93% coverage: 18:333/340 of query aligns to 12:326/494 of 1tdjA
- active site: K58 (= K64), A83 (= A89), E209 (= E216), S213 (= S220), C215 (= C222), G237 (= G244), L310 (≠ N317), S311 (= S318)
- binding pyridoxal-5'-phosphate: F57 (= F63), K58 (= K64), N85 (= N91), G184 (= G191), G185 (= G192), G186 (= G193), G187 (= G194), G237 (= G244), E282 (= E289), S311 (= S318), G312 (= G319)
P04968 L-threonine dehydratase biosynthetic IlvA; Threonine deaminase; EC 4.3.1.19 from Escherichia coli (strain K12) (see paper)
54% identity, 93% coverage: 18:333/340 of query aligns to 16:330/514 of P04968
- K62 (= K64) modified: N6-(pyridoxal phosphate)lysine
- N89 (= N91) binding
- GGGGL 188:192 (= GGGGL 191:195) binding
- S315 (= S318) binding
A4F2N8 L-threo-3-hydroxyaspartate ammonia-lyase; L-threo-3-hydroxyaspartate dehydratase; L-THA DH; EC 4.3.1.16 from Pseudomonas sp. (see paper)
39% identity, 87% coverage: 30:326/340 of query aligns to 19:312/319 of A4F2N8
- K53 (= K64) mutation to A: Loss of enzymatic activity.
2gn2A Crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) (see paper)
38% identity, 92% coverage: 20:331/340 of query aligns to 16:322/326 of 2gn2A
- active site: K56 (= K64), A81 (= A89), Q207 (≠ E216), V211 (≠ S220), G213 (≠ C222), G235 (= G244), I308 (≠ N317), S309 (= S318)
- binding cytidine-5'-monophosphate: R51 (≠ P59), T52 (= T60), G53 (≠ F61), A114 (≠ G122), D117 (≠ S125), Y118 (≠ R126), N312 (= N321)
O59791 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 4.3.1.17; EC 4.3.1.18; EC 5.1.1.18 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
35% identity, 90% coverage: 23:329/340 of query aligns to 5:319/323 of O59791
- S82 (≠ A89) mutation to A: Loss of racemase activity. Reduces D-serine dehydratase activity by 99%. Slightly reduced L-serine dehydratase activity.
2zr8A Crystal structure of modified serine racemase complexed with serine (see paper)
35% identity, 90% coverage: 23:329/340 of query aligns to 1:315/319 of 2zr8A
- active site: K53 (= K64), S78 (≠ A89), E204 (= E216), G208 (≠ S220), D210 (≠ C222), G232 (= G244), I303 (≠ N317), S304 (= S318)
- binding magnesium ion: E204 (= E216), G208 (≠ S220), D210 (≠ C222)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F63), K53 (= K64), S77 (= S88), S78 (≠ A89), N80 (= N91), H81 (= H92), P147 (= P158), G179 (= G191), G180 (= G192), G181 (= G193), G182 (= G194), G232 (= G244), E277 (= E289), T279 (≠ S291), S304 (= S318)
- binding serine: S78 (≠ A89), R129 (≠ A140), D231 (= D243), G232 (= G244), A233 (≠ T245), Q234 (≠ A246), T235 (≠ V247)
2zpuA Crystal structure of modified serine racemase from s.Pombe. (see paper)
35% identity, 90% coverage: 23:329/340 of query aligns to 1:315/319 of 2zpuA
- active site: K53 (= K64), S78 (≠ A89), E204 (= E216), G208 (≠ S220), D210 (≠ C222), G232 (= G244), I303 (≠ N317), S304 (= S318)
- binding magnesium ion: E204 (= E216), G208 (≠ S220), D210 (≠ C222)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F63), K53 (= K64), S77 (= S88), S78 (≠ A89), N80 (= N91), H81 (= H92), P147 (= P158), G179 (= G191), G180 (= G192), G181 (= G193), G182 (= G194), G232 (= G244), E277 (= E289), T279 (≠ S291), S304 (= S318)
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
35% identity, 89% coverage: 27:329/340 of query aligns to 15:314/318 of 1wtcA
- active site: K52 (= K64), S77 (≠ A89), E203 (= E216), G207 (≠ S220), D209 (≠ C222), G231 (= G244), I302 (≠ N317), S303 (= S318)
- binding phosphomethylphosphonic acid adenylate ester: N20 (≠ V32), K47 (≠ P59), M48 (≠ T60), A109 (≠ L121), A110 (≠ G122), Y114 (≠ R126)
- binding magnesium ion: E203 (= E216), G207 (≠ S220), D209 (≠ C222)
- binding pyridoxal-5'-phosphate: F51 (= F63), K52 (= K64), N79 (= N91), G178 (= G191), G179 (= G192), G180 (= G193), G181 (= G194), G231 (= G244), E276 (= E289), T278 (≠ S291), S303 (= S318)
1v71A Crystal structure of s.Pombe serine racemase
35% identity, 89% coverage: 27:329/340 of query aligns to 15:314/318 of 1v71A
- active site: K52 (= K64), S77 (≠ A89), E203 (= E216), G207 (≠ S220), D209 (≠ C222), G231 (= G244), I302 (≠ N317), S303 (= S318)
- binding magnesium ion: E203 (= E216), G207 (≠ S220), D209 (≠ C222)
- binding pyridoxal-5'-phosphate: F51 (= F63), K52 (= K64), N79 (= N91), G178 (= G191), G179 (= G192), G180 (= G193), G181 (= G194), G231 (= G244), E276 (= E289), T278 (≠ S291), S303 (= S318), G304 (= G319)
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
36% identity, 86% coverage: 33:324/340 of query aligns to 37:329/339 of Q7XSN8
- E219 (= E216) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (≠ C222) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
36% identity, 86% coverage: 34:326/340 of query aligns to 23:318/320 of 7nbhAAA
- active site: K53 (= K64), S81 (≠ A89), E207 (= E216), A211 (≠ S220), D213 (≠ S221), G236 (= G244), L309 (≠ N317), S310 (= S318)
- binding calcium ion: E207 (= E216), A211 (≠ S220), D213 (≠ S221)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (≠ A89), G85 (≠ A93), Q86 (= Q94), K111 (= K119), I115 (≠ V123), Y118 (≠ R126), D235 (= D243), P281 (= P290), N313 (= N321), V314 (≠ I322), D315 (≠ N323)
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
36% identity, 86% coverage: 34:326/340 of query aligns to 23:318/323 of 7nbfAAA
- active site: K53 (= K64), S81 (≠ A89), E207 (= E216), A211 (≠ S220), D213 (≠ S221), G236 (= G244), L309 (≠ N317), S310 (= S318)
- binding calcium ion: E207 (= E216), A211 (≠ S220), D213 (≠ S221)
- binding magnesium ion: N244 (≠ H253)
- binding pyridoxal-5'-phosphate: F52 (= F63), K53 (= K64), N83 (= N91), G182 (= G191), G183 (= G192), G184 (= G193), G185 (= G194), M186 (≠ L195), G236 (= G244), V237 (≠ T245), T282 (≠ S291), S310 (= S318), G311 (= G319)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: T23 (= T34), P24 (= P35), L26 (≠ Q37), T27 (≠ A38), F46 (≠ L57)
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
36% identity, 86% coverage: 34:326/340 of query aligns to 23:318/323 of 7nbdAAA
- active site: K53 (= K64), S81 (≠ A89), E207 (= E216), A211 (≠ S220), D213 (≠ S221), G236 (= G244), L309 (≠ N317), S310 (= S318)
- binding calcium ion: E207 (= E216), A211 (≠ S220), D213 (≠ S221)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (≠ Y281), L278 (≠ I287), V314 (≠ I322), L316 (≠ F324)
- binding magnesium ion: N244 (≠ H253)
- binding pyridoxal-5'-phosphate: F52 (= F63), K53 (= K64), N83 (= N91), G182 (= G191), G183 (= G192), G184 (= G193), G185 (= G194), M186 (≠ L195), G236 (= G244), V237 (≠ T245), E280 (= E289), T282 (≠ S291), S310 (= S318), G311 (= G319)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
36% identity, 86% coverage: 34:326/340 of query aligns to 23:318/323 of 7nbcCCC
- active site: K53 (= K64), S81 (≠ A89), E207 (= E216), A211 (≠ S220), D213 (≠ S221), G236 (= G244), L309 (≠ N317), S310 (= S318)
- binding biphenyl-4-ylacetic acid: T78 (= T86), H79 (≠ A87), H84 (= H92), V148 (= V156), H149 (≠ S157), P150 (= P158)
- binding calcium ion: E207 (= E216), A211 (≠ S220), D213 (≠ S221)
- binding pyridoxal-5'-phosphate: F52 (= F63), K53 (= K64), N83 (= N91), G182 (= G191), G183 (= G192), G184 (= G193), G185 (= G194), M186 (≠ L195), G236 (= G244), V237 (≠ T245), T282 (≠ S291), S310 (= S318), G311 (= G319)
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
36% identity, 86% coverage: 34:326/340 of query aligns to 23:318/323 of 7nbcAAA
- active site: K53 (= K64), S81 (≠ A89), E207 (= E216), A211 (≠ S220), D213 (≠ S221), G236 (= G244), L309 (≠ N317), S310 (= S318)
- binding calcium ion: E207 (= E216), A211 (≠ S220), D213 (≠ S221)
- binding magnesium ion: N244 (≠ H253)
- binding pyridoxal-5'-phosphate: F52 (= F63), K53 (= K64), N83 (= N91), G182 (= G191), G183 (= G192), G184 (= G193), G185 (= G194), M186 (≠ L195), G236 (= G244), V237 (≠ T245), T282 (≠ S291), S310 (= S318), G311 (= G319)
Sites not aligning to the query:
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
36% identity, 86% coverage: 34:326/340 of query aligns to 23:318/322 of 7nbgAAA
- active site: K53 (= K64), S81 (≠ A89), E207 (= E216), A211 (≠ S220), D213 (≠ S221), G236 (= G244), L309 (≠ N317), S310 (= S318)
- binding calcium ion: E207 (= E216), A211 (≠ S220), D213 (≠ S221)
- binding pyridoxal-5'-phosphate: F52 (= F63), K53 (= K64), N83 (= N91), G182 (= G191), G183 (= G192), G184 (= G193), G185 (= G194), M186 (≠ L195), G236 (= G244), V237 (≠ T245), T282 (≠ S291), S310 (= S318), G311 (= G319)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (≠ A89), G85 (≠ A93), Q86 (= Q94), I101 (= I109), K111 (= K119), I115 (≠ V123), Y118 (≠ R126)
6zspAAA serine racemase bound to atp and malonate. (see paper)
36% identity, 86% coverage: 34:326/340 of query aligns to 23:311/320 of 6zspAAA
- active site: K53 (= K64), S74 (≠ A89), E200 (= E216), A204 (≠ S220), D206 (≠ S221), G229 (= G244), L302 (≠ N317), S303 (= S318)
- binding adenosine-5'-triphosphate: S28 (≠ A39), S29 (≠ P40), I30 (≠ A41), K48 (≠ P59), T49 (= T60), Q79 (= Q94), Y111 (≠ R126), E266 (≠ D282), R267 (≠ D283), K269 (≠ R285), N306 (= N321)
- binding magnesium ion: E200 (= E216), A204 (≠ S220), D206 (≠ S221)
- binding malonate ion: K53 (= K64), S73 (= S88), S74 (≠ A89), N76 (= N91), H77 (= H92), R125 (≠ A140), G229 (= G244), S232 (≠ A248)
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
35% identity, 86% coverage: 34:326/340 of query aligns to 24:314/322 of 3l6bA
- active site: K54 (= K64), S77 (≠ A89), E203 (= E216), A207 (≠ S220), D209 (≠ S221), G232 (= G244), T278 (≠ S291), L305 (≠ N317), S306 (= S318)
- binding malonate ion: K54 (= K64), S76 (= S88), S77 (≠ A89), N79 (= N91), H80 (= H92), R128 (≠ A140), G232 (= G244)
- binding manganese (ii) ion: E203 (= E216), A207 (≠ S220), D209 (≠ S221)
- binding pyridoxal-5'-phosphate: F53 (= F63), K54 (= K64), N79 (= N91), G178 (= G191), G179 (= G192), G180 (= G193), G181 (= G194), M182 (≠ L195), V233 (≠ T245), E276 (= E289), T278 (≠ S291), S306 (= S318), G307 (= G319)
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
35% identity, 85% coverage: 34:323/340 of query aligns to 23:310/310 of 7nbgDDD
- active site: K53 (= K64), S76 (≠ A89), E202 (= E216), A206 (≠ S220), D208 (≠ S221), G231 (= G244), L304 (≠ N317), S305 (= S318)
- binding calcium ion: E202 (= E216), A206 (≠ S220), D208 (≠ S221)
- binding magnesium ion: N239 (≠ H253)
- binding ortho-xylene: S76 (≠ A89), Q81 (= Q94), I96 (= I109), Y113 (≠ R126)
- binding pyridoxal-5'-phosphate: F52 (= F63), K53 (= K64), N78 (= N91), G177 (= G191), G178 (= G192), G179 (= G193), G180 (= G194), M181 (≠ L195), G231 (= G244), V232 (≠ T245), E275 (= E289), T277 (≠ S291), S305 (= S318), G306 (= G319)
Sites not aligning to the query:
5cvcA Structure of maize serine racemase (see paper)
37% identity, 87% coverage: 33:327/340 of query aligns to 21:316/329 of 5cvcA
- active site: K52 (= K64), S77 (≠ A89), E203 (= E216), A207 (≠ S220), D209 (≠ C222), G231 (= G244), V306 (≠ N317), S307 (= S318)
- binding magnesium ion: E203 (= E216), A207 (≠ S220), D209 (≠ C222)
- binding pyridoxal-5'-phosphate: F51 (= F63), K52 (= K64), N79 (= N91), S178 (≠ G191), G179 (= G192), G180 (= G193), G181 (= G194), L232 (≠ T245), E275 (= E289), S307 (= S318), G308 (= G319)
Query Sequence
>GFF2483 FitnessBrowser__WCS417:GFF2483
MSSCTAPHTADPGLLEHYVKKILAAPVYDLAVRTPLQAAPALSALLGNQVLLKREDLQPT
FSFKIRGAYNKLVQLTPEQRARGVVTASAGNHAQGVALAARELGIKARIVMPASTPELKV
LGVRSRGAQAVLHGASFPFALAYALQLAESSGCTFVSPFDDPDVIAGQGTVAMEILRQQQ
GPLDAIFVPVGGGGLIAGVAAYVKYLRPDVRIIGVEPEGSSCLLAALRAGERVVLPSVDG
FADGTAVAQVGAHGFEICRDWVDEVITVSNDALCSAIKLIYDDTRSITEPSGALAVAGIR
QYVATHNLRGQTLVAINSGANINFDSLRHVAERVAAQSVV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory