Comparing GFF2487 FitnessBrowser__WCS417:GFF2487 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4wjmA Crystal structure of fructokinase from brucella abortus 2308 with bound amppnp
35% identity, 100% coverage: 1:311/312 of query aligns to 7:312/312 of 4wjmA
7fcaD Pfkb(mycobacterium marinum) (see paper)
34% identity, 96% coverage: 3:301/312 of query aligns to 5:276/282 of 7fcaD
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
32% identity, 78% coverage: 26:268/312 of query aligns to 21:263/306 of 5eynA
Sites not aligning to the query:
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
31% identity, 78% coverage: 26:268/312 of query aligns to 25:267/310 of 5yggA
Sites not aligning to the query:
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
27% identity, 96% coverage: 5:302/312 of query aligns to 5:282/302 of 3gbuA
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
27% identity, 96% coverage: 5:302/312 of query aligns to 6:283/304 of 3ih0A
3lkiB Crystal structure of fructokinase with bound atp from xylella fastidiosa
28% identity, 96% coverage: 3:302/312 of query aligns to 6:302/322 of 3lkiB
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
27% identity, 85% coverage: 4:268/312 of query aligns to 9:266/319 of Q8ZKR2
Sites not aligning to the query:
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
26% identity, 87% coverage: 33:303/312 of query aligns to 36:291/308 of 3iq0B
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
27% identity, 85% coverage: 4:268/312 of query aligns to 5:255/299 of 1tz3A
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
27% identity, 85% coverage: 4:268/312 of query aligns to 5:255/297 of 1tz6A
Sites not aligning to the query:
8cqxA Ribokinase from t.Sp mutant a92g
27% identity, 92% coverage: 26:311/312 of query aligns to 30:294/300 of 8cqxA
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
26% identity, 78% coverage: 26:267/312 of query aligns to 32:265/306 of 4xckA
Sites not aligning to the query:
6znxC Ribokinase from thermus species
28% identity, 100% coverage: 1:311/312 of query aligns to 1:259/265 of 6znxC
7aghA Crystal structure of sf kinase yihv from e. Coli in complex with amppnp-mg (see paper)
27% identity, 91% coverage: 19:302/312 of query aligns to 25:277/295 of 7aghA
7ag6A Crystal structure of sf kinase yihv from e. Coli in complex with sulfofructose (sf), adp-mg (see paper)
27% identity, 91% coverage: 19:302/312 of query aligns to 25:279/302 of 7ag6A
Sites not aligning to the query:
7agkA Crystal structure of e. Coli sf kinase (yihv) in complex with product sulfofructose phosphate (sfp) (see paper)
27% identity, 91% coverage: 19:302/312 of query aligns to 25:279/298 of 7agkA
Sites not aligning to the query:
P32143 Sulfofructose kinase; SF kinase; EC 2.7.1.184 from Escherichia coli (strain K12) (see paper)
27% identity, 91% coverage: 19:302/312 of query aligns to 25:279/298 of P32143
Sites not aligning to the query:
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
26% identity, 94% coverage: 3:294/312 of query aligns to 5:284/300 of 1v1bA
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
26% identity, 94% coverage: 3:294/312 of query aligns to 5:284/301 of 1v1aA
Sites not aligning to the query:
>GFF2487 FitnessBrowser__WCS417:GFF2487
MYLVCGEALFDFFSEEDASGQASKVNYKAIAGGSPFNVAVGLRRLGIEAGLFGGLSTDFL
GRRLLQVLKDEGVSEQFLVEFAAPTTLSMVAVGANGSPQYNFRGEGCADRLLEVAHLPEL
GDDIRGLHIGSFSLVVQPIGDTLLSLVKRESGKRLISLDPNVRLNPQPDIQLWRDRVAEL
VKHADLIKVSDEDLHLLYPEQSPESVLQGWLQHRCQLVFLTQGGDGASVFSRQHGHWSQP
AVKVVMADTVGAGDTFQAALIAWLTEQQFDSIDGLQQLSRDQIDAMLGFAIRAAALTCTK
TGPDLPYRRQVS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory