Comparing GFF2488 FitnessBrowser__WCS417:GFF2488 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3i8bA The crystal structure of xylulose kinase from bifidobacterium adolescentis
33% identity, 97% coverage: 4:482/493 of query aligns to 3:504/506 of 3i8bA
P09099 Xylulose kinase; XK; Xylulokinase; 1-deoxy-D-xylulokinase; EC 2.7.1.17; EC 2.7.1.- from Escherichia coli (strain K12) (see paper)
34% identity, 99% coverage: 6:493/493 of query aligns to 1:479/484 of P09099
2itmA Crystal structure of the e. Coli xylulose kinase complexed with xylulose (see paper)
33% identity, 99% coverage: 6:493/493 of query aligns to 1:471/476 of 2itmA
3ll3A The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
27% identity, 89% coverage: 8:444/493 of query aligns to 6:437/492 of 3ll3A
3ll3B The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
27% identity, 89% coverage: 8:444/493 of query aligns to 5:435/490 of 3ll3B
3kzbA Crystal structure of xylulokinase from chromobacterium violaceum
27% identity, 89% coverage: 10:449/493 of query aligns to 9:456/498 of 3kzbA
6k76A Glycerol kinase form thermococcus kodakarensis, complex structure with substrate.
25% identity, 89% coverage: 8:444/493 of query aligns to 2:431/485 of 6k76A
O34154 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus faecalis (strain ATCC 700802 / V583) (see 2 papers)
24% identity, 90% coverage: 1:444/493 of query aligns to 1:447/501 of O34154
5ya1A Crystal structure of lsrk-hpr complex with atp (see paper)
24% identity, 89% coverage: 7:444/493 of query aligns to 5:438/478 of 5ya1A
5ya2A Crystal structure of lsrk-hpr complex with adp (see paper)
24% identity, 89% coverage: 7:444/493 of query aligns to 5:438/478 of 5ya2A
3qdkA Structural insight on mechanism and diverse substrate selection strategy of ribulokinase (see paper)
23% identity, 98% coverage: 8:489/493 of query aligns to 4:527/546 of 3qdkA
3l0qA The crystal structure of xlylulose kinase from yersinia pseudotuberculosis
22% identity, 98% coverage: 7:489/493 of query aligns to 4:529/541 of 3l0qA
3ge1A 2.7 angstrom crystal structure of glycerol kinase (glpk) from staphylococcus aureus in complex with adp and glycerol
23% identity, 89% coverage: 4:444/493 of query aligns to 3:447/499 of 3ge1A
Q5HGD2 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Staphylococcus aureus (strain COL)
23% identity, 89% coverage: 4:444/493 of query aligns to 2:446/498 of Q5HGD2
O34153 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus casseliflavus (Enterococcus flavescens) (see 3 papers)
22% identity, 90% coverage: 1:444/493 of query aligns to 1:448/506 of O34153
5huxA Putative sugar kinases from synechococcus elongatus pcc7942 in complex with adp (see paper)
26% identity, 87% coverage: 8:436/493 of query aligns to 5:404/429 of 5huxA
5htpA Putative sugar kinases from synechococcus elongatus pcc7942 in complex with amppnp (see paper)
26% identity, 87% coverage: 8:436/493 of query aligns to 4:403/419 of 5htpA
5hv7A Putative sugar kinases from synechococcus elongatus pcc7942 in complex with d-ribulose (see paper)
26% identity, 87% coverage: 8:436/493 of query aligns to 5:404/421 of 5hv7A
Q31KC7 D-ribulose kinase; D-ribulokinase; Probable sugar kinase; SePSK; EC 2.7.1.47 from Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805) (Anacystis nidulans R2) (see paper)
26% identity, 87% coverage: 8:436/493 of query aligns to 5:404/426 of Q31KC7
3h3nX Glycerol kinase h232r with glycerol (see paper)
22% identity, 90% coverage: 3:444/493 of query aligns to 2:447/501 of 3h3nX
>GFF2488 FitnessBrowser__WCS417:GFF2488
MTQQNLFLGIDCGTQGTKAIVLDASSGKVLGLGAAAHTLISGANGRREQHTQEWLDAFTE
ATHRALQQAGVDGQDILGIGVSGQQHGLVLLDDQGRVLRPAKLWCDTETAPENERLLQHL
GGESGSLERLGVAIAPGYTVSKLLWTREQHPDIFARITHILLPHDYLNYWLTGRAVAEYG
DASGTGYFNVRTREWDVALLKHIDPSGRLENALPQLIEADQSVGTILPAIAERLGINPNA
IVSSGGGDNMMGAIGTGNIAPGVITMSLGSSGTVYAFADQPSVSPQASVATFCSSSGGWL
PLICTMNLTNATGVIRELFDLDLTAFNALVEQAPIGADGVSMLPFLNGERVPALPHATGS
LHGLTMTNLTRANLCRAVVEGTTFGLRYGLDLLRQTGLQSQSIRLIGGGSKSPIWRQMVA
DIMNTEVVCTEQSEAAALGAAIQAAWSQSGESLASLCDKCVSVDPASRTLPVAASVSAYQ
QAYERYQQLVATL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory