Comparing GFF249 FitnessBrowser__Phaeo:GFF249 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
33% identity, 98% coverage: 1:251/255 of query aligns to 2:253/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
33% identity, 98% coverage: 1:251/255 of query aligns to 2:253/253 of 1g9xB
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
33% identity, 91% coverage: 12:244/255 of query aligns to 35:255/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
33% identity, 91% coverage: 12:244/255 of query aligns to 35:255/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
33% identity, 91% coverage: 12:244/255 of query aligns to 35:255/260 of 7ahdC
Sites not aligning to the query:
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
32% identity, 94% coverage: 10:248/255 of query aligns to 12:237/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
32% identity, 94% coverage: 10:248/255 of query aligns to 12:237/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
32% identity, 94% coverage: 10:248/255 of query aligns to 12:237/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
32% identity, 94% coverage: 10:248/255 of query aligns to 12:237/353 of Q97UY8
3d31A Modbc from methanosarcina acetivorans (see paper)
31% identity, 95% coverage: 3:243/255 of query aligns to 1:219/348 of 3d31A
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 89% coverage: 16:243/255 of query aligns to 18:232/343 of P30750
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 91% coverage: 13:243/255 of query aligns to 27:239/378 of P69874
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
30% identity, 89% coverage: 16:243/255 of query aligns to 19:233/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
30% identity, 89% coverage: 16:243/255 of query aligns to 19:233/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
30% identity, 89% coverage: 16:243/255 of query aligns to 19:233/344 of 3tuiC
Sites not aligning to the query:
8hprD Lpqy-sugabc in state 4 (see paper)
30% identity, 93% coverage: 18:255/255 of query aligns to 18:239/362 of 8hprD
Sites not aligning to the query:
8hplC Lpqy-sugabc in state 1 (see paper)
30% identity, 93% coverage: 18:255/255 of query aligns to 16:237/384 of 8hplC
Sites not aligning to the query:
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
29% identity, 100% coverage: 1:255/255 of query aligns to 1:240/393 of P9WQI3
8hprC Lpqy-sugabc in state 4 (see paper)
30% identity, 93% coverage: 18:255/255 of query aligns to 18:239/363 of 8hprC
Sites not aligning to the query:
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
28% identity, 98% coverage: 2:251/255 of query aligns to 1:235/240 of 6mjpA
>GFF249 FitnessBrowser__Phaeo:GFF249
MSLLEIEHATLKFGGVVAVNDLSFSVEEGEVYAIVGPNGAGKSTVFNLISRFYQPHSGRL
SFDGRDLLQSKADAVADLGIARTFQNIELFDHATVLQNLLVGRHRHRRSTLMEELFFTPR
VRREERRHRAAVEEVIDFLDLQAYRDKMIAGLPYGVRKVVELGRALASGPRLLLLDEPAS
GLSVEETRDMRWWIDDIRKQMGITVLMVEHDMGLVSSVSDRVLALADGAKLAEGTPAEVQ
ANPAVIEAYLGAGAV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory