Comparing GFF2491 FitnessBrowser__Phaeo:GFF2491 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
4wjiA Crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with NADP and tyrosine
62% identity, 95% coverage: 6:295/306 of query aligns to 4:293/293 of 4wjiA
3gggD The crystal structure of a. Aeolicus prephenate dehydrogenase in complex with tyrosine and NAD+ (see paper)
33% identity, 92% coverage: 7:288/306 of query aligns to 14:293/293 of 3gggD
3ggoA Crystal structure of prephenate dehydrogenase from a. Aeolicus with hpp and nadh (see paper)
33% identity, 92% coverage: 7:288/306 of query aligns to 6:285/285 of 3ggoA
3ggpA Crystal structure of prephenate dehydrogenase from a. Aeolicus in complex with hydroxyphenyl propionate and NAD+ (see paper)
33% identity, 92% coverage: 7:288/306 of query aligns to 6:285/286 of 3ggpA
6u60B Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with NAD and l-tyrosine (see paper)
30% identity, 94% coverage: 7:294/306 of query aligns to 2:295/365 of 6u60B
Sites not aligning to the query:
5uyyA Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with l-tyrosine (see paper)
30% identity, 94% coverage: 7:294/306 of query aligns to 10:303/373 of 5uyyA
Sites not aligning to the query:
3b1fA Crystal structure of prephenate dehydrogenase from streptococcus mutans (see paper)
33% identity, 92% coverage: 9:288/306 of query aligns to 9:285/286 of 3b1fA
2f1kA Crystal structure of synechocystis arogenate dehydrogenase (see paper)
27% identity, 92% coverage: 8:290/306 of query aligns to 2:279/279 of 2f1kA
5t9fB Prephenate dehydrogenase n222d mutant from soybean (see paper)
23% identity, 85% coverage: 8:266/306 of query aligns to 4:241/253 of 5t9fB
>GFF2491 FitnessBrowser__Phaeo:GFF2491
MSAPIYNRIALIGLGLIASSMAHAIRRGGLASEITGYARSAETRDTARRINLCDRVCDTA
AEAAQDADLIVLCVPVGAMDAVMADIAPVLKPGATVSDVGSVKRHVIDAVQPHIPEGVHF
VPAHPLAGTEHSGPEAGFAELYDNRWCLLVPVEGSDRAPVDRLRQLWEGMGANVDEMDAD
HHDLVLAVTSHAPHLIAYTMVGVADDLRRVTDSEVIKYSAAGFRDFTRIAASDPTMWRDV
FLTNKDATLEILGRFTEELFALQRAIRTGDGEHLHQYFTRTRAIRRGIIEAGQDTAAPNF
GRETKS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory