SitesBLAST – Find functional sites

 

SitesBLAST

Comparing GFF2491 FitnessBrowser__WCS417:GFF2491 to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found 3 hits to proteins with known functional sites (download)

P94530 Arabinooligosaccharides transport system permease protein AraQ from Bacillus subtilis (strain 168) (see paper)
27% identity, 93% coverage: 21:276/276 of query aligns to 22:280/281 of P94530

query
sites
P94530
I
 
L
A
 
S
I
 
L
L
 
L
I
 
Y
F
 
L
F
 
F
P
 
P
I
 
I
F
 
F
W
 
C
M
 
L
V
 
L
L
 
L
T
 
G
S
 
S
F
 
L
K
 
K
T
 
P
E
 
S
I
 
S
D
 
E
A
 
L
F
 
L
A
 
R
T
 
V
P
 
G
P
 
L
Q
 
N
F
 
L
I
 
D
F
 
I
T
 
D
P
 
P
-
 
K
-
 
V
-
 
M
T
 
S
L
 
F
E
 
D
N
 
N
Y
 
Y
L
 
T
H
 
F
I
 
L
-
 
F
N
 
N
E
 
G
R
 
G
S
 
S
N
 
I
Y
 
Y
F
 
F
S
 
K
Y
 
W
A
 
F
W
 
F
N
 
N
S
 
S
V
 
L
L
 
V
I
 
L
S
 
G
F
 
L
S
 
F
A
 
T
T
 
T
A
 
V
L
 
L
C
 
T
L
 
L
L
 
F
I
 
F
S
 
S
V
 
S
P
 
M
A
 
I
A
 
G
Y
 
Y
S
 
G
M
 
L
A
 
A
F
 
V
Y
 
Y
E
 
D
T
 
F
Q
 
K
R
 
G
T
 
R
K
 
N
G
 
I
T
 
I
L
 
F
L
 
V
W
 
L
M
 
V
L
 
L
S
 
I
T
 
I
K
 
M
M
 
M
L
 
V
P
 
P
P
 
L
V
 
E
G
 
V
V
 
M
L
 
M
M
 
L
P
 
P
I
 
L
Y
 
F
L
 
K
L
 
L
A
 
T
K
 
V
S
 
G
F
 
L
G
 
H
L
 
L
L
 
I
D
 
D
T
 
S
R
 
Y
I
 
T
A
 
G
L
 
V
I
 
I
I
 
L
I
 
P
Y
 
F
T
 
-
L
 
-
I
 
I
N
 
V
L
 
S
P
 
P
I
 
V
V
 
A
V
 
V
W
 
F
M
 
F
V
 
F
Y
 
R
T
 
Q
Y
 
Y
F
 
A
K
 
L
D
 
G
I
 
L
P
 
P
K
 
R
D
 
D
I
 
L
L
 
L
E
 
D
A
 
S
A
 
A
R
 
R
L
 
M
D
|
D
G
 
G
A
 
C
T
 
T
L
 
E
W
 
F
Q
 
G
E
 
I
M
 
F
V
 
F
R
 
R
V
 
I
L
 
M
L
 
A
P
 
P
I
 
L
A
 
M
K
 
K
G
 
P
G
 
A
L
 
F
A
 
G
S
 
A
T
 
M
V
 
I
L
 
I
L
 
L
S
 
Q
L
 
S
I
 
L
L
 
N
C
 
S
W
 
W
N
 
N
E
 
N
A
 
F
F
 
L
W
 
W
S
 
P
L
 
L
-
 
I
N
 
V
L
 
L
T
 
R
S
 
S
S
 
K
S
 
E
A
 
M
A
 
F
P
 
T
L
 
L
T
 
P
A
 
I
L
 
G
I
 
L
A
 
S
S
 
S
Y
 
L
S
 
L
S
 
S
P
 
P
E
 
Y
G
 
G
L
 
N
F
 
N
W
 
Y
A
 
D
K
 
M
L
 
L
S
 
I
A
 
S
V
 
G
S
 
S
T
 
V
L
 
F
A
 
A
C
 
I
A
 
L
P
 
P
I
 
V
L
 
I
I
 
I
F
 
I
G
 
F
W
 
L
I
 
F
S
 
F
Q
 
Q
K
 
K
Q
 
Y
L
 
F
V
 
I
R
 
S
G
 
G
L
 
L
S
 
T
F
 
V
G
 
G
A
 
G
V
 
V
K
 
K

8hpsB ABC transporter, permease protein SugB (see paper)
29% identity, 77% coverage: 55:267/276 of query aligns to 48:263/264 of 8hpsB

query
sites
8hpsB
T
 
T
L
 
F
E
 
A
N
 
N
Y
 
Y
L
 
K
H
 
A
I
 
I
N
 
F
E
 
S
R
 
G
S
 
D
N
 
A
Y
 
F
F
 
T
S
 
S
Y
 
A
A
 
L
W
 
F
N
 
N
S
 
S
V
 
I
L
 
G
I
 
I
S
 
G
F
 
L
S
 
I
A
 
T
T
 
T
A
 
I
L
 
I
C
 
A
L
 
V
L
 
V
I
 
I
S
 
G
V
 
G
P
 
M
A
 
A
A
 
A
Y
 
Y
S
 
A
M
 
V
A
 
A
F
 
R
Y
 
L
E
 
Q
T
 
F
Q
 
P
R
 
G
T
 
K
K
 
Q
G
 
L
T
 
L
L
 
I
L
 
G
W
 
V
M
 
A
L
 
L
S
 
L
T
 
I
K
 
A
M
 
M
L
 
F
P
 
P
P
x
H
V
 
I
G
 
S
V
 
L
L
 
V
M
 
T
P
 
P
I
 
I
Y
 
F
L
 
N
L
 
M
A
 
W
K
 
R
S
 
G
F
 
I
G
 
G
L
 
L
L
 
F
D
 
D
T
 
T
R
 
W
I
 
P
A
 
G
L
 
L
I
 
I
I
 
I
I
 
P
Y
 
Y
T
 
I
L
 
T
I
 
F
N
 
A
L
 
L
P
 
P
I
 
L
V
 
A
V
 
I
W
 
Y
M
 
T
V
 
L
Y
 
S
T
 
A
Y
 
F
F
 
F
K
 
R
D
 
E
I
 
I
P
 
P
K
 
W
D
 
D
I
 
L
L
 
E
E
 
K
A
 
A
A
 
A
R
 
K
L
 
M
D
 
D
G
 
G
A
 
A
T
 
T
L
 
P
W
 
A
Q
 
Q
E
 
A
M
 
F
V
 
R
R
 
K
V
 
V
L
 
I
L
 
A
P
 
P
I
 
L
A
 
A
K
 
A
G
 
P
G
 
G
L
 
I
A
 
V
S
 
T
T
 
A
V
 
A
L
 
I
L
 
L
S
 
V
L
 
F
I
 
I
L
x
F
C
 
A
W
 
W
N
 
N
E
 
D
A
 
L
F
 
L
W
 
L
S
 
A
L
 
L
N
 
S
L
 
L
T
 
T
S
 
A
S
 
T
S
 
Q
A
 
R
A
 
A
P
 
-
L
 
I
T
 
T
A
 
A
L
 
P
I
 
V
A
 
A
-
 
I
-
 
A
-
 
N
-
 
F
-
 
T
-
 
G
-
 
S
-
 
S
S
 
Q
Y
 
F
S
 
E
S
 
E
P
 
P
E
 
T
G
 
G
L
 
-
F
 
-
W
 
-
A
 
-
K
 
S
L
 
I
S
 
A
A
 
A
V
 
G
S
 
A
T
 
M
L
 
V
A
 
I
C
 
T
A
 
I
P
 
P
I
 
I
L
 
I
I
 
I
F
 
F
G
 
V
W
 
L
I
 
I
S
 
F
Q
 
Q
K
 
R
Q
 
R
L
 
I
V
 
V

P68183 Maltose/maltodextrin transport system permease protein MalG from Escherichia coli (strain K12) (see 2 papers)
32% identity, 74% coverage: 73:276/276 of query aligns to 86:295/296 of P68183

query
sites
P68183
W
 
W
N
 
N
S
 
S
V
 
V
L
 
K
I
 
V
S
 
A
F
 
G
S
 
I
A
 
S
T
 
A
A
 
I
L
 
G
C
 
I
L
 
V
L
 
A
I
 
L
S
 
S
V
 
T
P
 
T
A
 
C
A
 
A
Y
 
Y
S
 
A
M
 
F
A
 
A
F
 
R
Y
 
M
E
 
R
T
 
F
Q
 
P
R
 
G
T
 
K
K
 
A
G
 
T
T
 
L
L
 
L
L
 
K
W
 
G
M
 
M
L
 
L
S
 
I
T
 
F
K
 
Q
M
 
M
L
 
F
P
 
P
P
 
A
V
 
V
G
 
L
V
 
S
L
 
L
M
 
V
P
 
A
I
 
L
Y
 
Y
L
 
A
L
 
L
A
 
F
K
 
D
S
 
R
F
 
L
G
 
G
L
 
E
-
 
Y
-
 
I
-
 
P
-
 
F
-
 
I
-
 
G
L
 
L
D
 
N
T
 
T
R
 
H
I
 
G
A
 
G
L
 
V
I
 
I
I
 
F
I
 
A
Y
 
Y
T
 
-
L
 
L
I
 
G
N
 
G
L
 
I
P
 
A
I
 
L
V
 
H
V
 
V
W
 
W
M
 
T
V
 
I
Y
 
K
T
 
G
Y
 
Y
F
 
F
K
 
E
D
 
T
I
 
I
P
 
D
K
 
S
D
 
S
I
 
L
L
 
E
E
|
E
A
 
A
A
|
A
R
 
A
L
 
L
D
 
D
G
|
G
A
 
A
T
 
T
L
 
P
W
 
W
Q
 
Q
E
 
A
M
 
F
V
 
R
R
 
L
V
 
V
L
 
L
L
 
L
P
|
P
I
 
L
A
 
S
K
 
V
G
 
P
G
 
I
L
 
L
A
 
A
S
 
V
T
 
V
V
 
F
L
 
I
L
 
L
S
 
S
L
 
F
I
 
I
L
 
A
C
 
A
W
 
I
N
 
T
E
 
E
A
 
V
-
 
P
F
 
V
W
 
A
S
 
S
L
 
L
N
 
L
L
 
L
T
 
R
S
 
D
S
 
V
S
 
N
A
 
S
A
 
Y
P
 
T
L
 
L
T
 
A
A
 
V
L
 
G
I
 
M
A
 
Q
S
 
Q
Y
 
Y
S
 
L
S
 
N
P
 
P
E
 
Q
G
 
N
L
 
Y
F
 
L
W
 
W
A
 
G
K
 
D
L
 
F
S
 
A
A
 
A
V
 
A
S
 
A
T
 
V
L
 
M
A
 
S
C
 
A
A
 
L
P
 
P
I
 
I
L
 
T
I
 
I
F
 
V
G
 
F
W
 
L
I
 
L
S
 
A
Q
 
Q
K
 
R
Q
 
W
L
 
L
V
 
V
R
 
N
G
 
G
L
 
L
S
 
T
F
 
A
G
 
G
A
 
G
V
 
V
K
 
K

Query Sequence

>GFF2491 FitnessBrowser__WCS417:GFF2491
MTLQQSRRLQSLLLGTLAWAIAILIFFPIFWMVLTSFKTEIDAFATPPQFIFTPTLENYL
HINERSNYFSYAWNSVLISFSATALCLLISVPAAYSMAFYETQRTKGTLLWMLSTKMLPP
VGVLMPIYLLAKSFGLLDTRIALIIIYTLINLPIVVWMVYTYFKDIPKDILEAARLDGAT
LWQEMVRVLLPIAKGGLASTVLLSLILCWNEAFWSLNLTSSSAAPLTALIASYSSPEGLF
WAKLSAVSTLACAPILIFGWISQKQLVRGLSFGAVK

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory