Comparing GFF2492 FitnessBrowser__Phaeo:GFF2492 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8bj3A Crystal structure of medicago truncatula histidinol-phosphate aminotransferase (hisn6) in complex with histidinol-phosphate (see paper)
32% identity, 90% coverage: 28:353/361 of query aligns to 33:356/360 of 8bj3A
Sites not aligning to the query:
4r5zA Crystal structure of rv3772 encoded aminotransferase (see paper)
38% identity, 63% coverage: 24:251/361 of query aligns to 19:250/353 of 4r5zA
4r2nA Crystal structure of rv3772 in complex with its substrate (see paper)
38% identity, 63% coverage: 24:251/361 of query aligns to 19:250/353 of 4r2nA
Sites not aligning to the query:
4r8dA Crystal structure of rv1600 encoded aminotransferase in complex with plp-mes from mycobacterium tuberculosis
31% identity, 86% coverage: 30:341/361 of query aligns to 30:346/369 of 4r8dA
3cq6A Histidinol-phosphate aminotransferase from corynebacterium glutamicum holo-form (plp covalently bound ) (see paper)
30% identity, 91% coverage: 31:357/361 of query aligns to 29:361/364 of 3cq6A
Sites not aligning to the query:
3cq5B Histidinol-phosphate aminotransferase from corynebacterium glutamicum in complex with pmp (see paper)
30% identity, 91% coverage: 31:357/361 of query aligns to 31:363/366 of 3cq5B
4wbtA Crystal structure of histidinol-phosphate aminotransferase from sinorhizobium meliloti in complex with pyridoxal-5'-phosphate
28% identity, 91% coverage: 25:353/361 of query aligns to 29:361/369 of 4wbtA
Q9X0D0 Histidinol-phosphate aminotransferase; Imidazole acetol-phosphate transaminase; EC 2.6.1.9 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
31% identity, 91% coverage: 30:357/361 of query aligns to 22:335/335 of Q9X0D0
1uu0A Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
30% identity, 91% coverage: 30:356/361 of query aligns to 16:328/328 of 1uu0A
1uu1A Complex of histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
30% identity, 91% coverage: 30:356/361 of query aligns to 17:329/329 of 1uu1A
1h1cA Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (see paper)
30% identity, 91% coverage: 30:356/361 of query aligns to 17:329/329 of 1h1cA
2f8jA Crystal structure of histidinol-phosphate aminotransferase (ec 2.6.1.9) (imidazole acetol-phosphate transferase) (tm1040) from thermotoga maritima at 2.40 a resolution
30% identity, 91% coverage: 30:356/361 of query aligns to 23:335/335 of 2f8jA
3ly1D Crystal structure of putative histidinol-phosphate aminotransferase (yp_050345.1) from erwinia carotovora atroseptica scri1043 at 1.80 a resolution
27% identity, 81% coverage: 17:307/361 of query aligns to 6:302/354 of 3ly1D
1fg7A Crystal structure of l-histidinol phosphate aminotransferase with pyridoxal-5'-phosphate (see paper)
29% identity, 86% coverage: 43:354/361 of query aligns to 38:350/354 of 1fg7A
1fg3A Crystal structure of l-histidinol phosphate aminotransferase complexed with l-histidinol (see paper)
29% identity, 86% coverage: 43:354/361 of query aligns to 38:350/354 of 1fg3A
Sites not aligning to the query:
1geyA Crystal structure of histidinol-phosphate aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate (see paper)
28% identity, 91% coverage: 24:353/361 of query aligns to 8:335/335 of 1geyA
7szpA Crystal structure of histidinol-phosphate aminotransferase from klebsiella pneumoniae subsp. Pneumoniae (strain hs11286)
29% identity, 89% coverage: 32:353/361 of query aligns to 32:349/353 of 7szpA
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
28% identity, 74% coverage: 25:292/361 of query aligns to 23:311/388 of 1gdeA
Sites not aligning to the query:
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
28% identity, 74% coverage: 25:292/361 of query aligns to 23:311/388 of 1gd9A
1v2fA Crystal structure of t.Th hb8 glutamine aminotransferase complex with 3-phenylpropionate (see paper)
28% identity, 70% coverage: 37:290/361 of query aligns to 37:299/368 of 1v2fA
Sites not aligning to the query:
>GFF2492 FitnessBrowser__Phaeo:GFF2492
MTHIAPQPGILDIALYEGGAAHVKGMSNVTKLSSNENPLGPSPKAIEAMQAAVSEMHRYP
SSDHSGLRQAIGEVYGLPMEQIICGAGSDEIITFLCQAYAGPGDEVLFTEHGFAMYRISA
LAAGATPVEVAERDRVTDVDALLAGCTERTRLVFIANPNNPTGTMIGMADLARLADGLPK
GALLVLDGAYAEYVEGYDAGAALVANRDNVVMTRTFSKIYGLGGARVGWGYAPKPIIDVL
NRVRGPFNLSSTALAGAEAAVRDTDYTEHCRKENAKWRTWLAEALAELGVPSDTSCANFI
LARFASPEEAGACDAFLQSRGLIVRRVTGYKLPAALRITVGDETACNALVAAMKVFKDGP
A
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory