SitesBLAST
Comparing GFF2513 FitnessBrowser__Marino:GFF2513 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3h0mA Structure of tRNA-dependent amidotransferase gatcab from aquifex aeolicus (see paper)
52% identity, 100% coverage: 1:484/485 of query aligns to 2:476/478 of 3h0mA
- active site: K72 (= K76), S147 (= S155), S148 (= S156), S166 (≠ T174), T168 (= T176), G169 (= G177), G170 (= G178), S171 (= S179), Q174 (= Q182)
- binding glutamine: M122 (= M126), G123 (= G127), D167 (= D175), T168 (= T176), G169 (= G177), G170 (= G178), S171 (= S179), F199 (= F207), Y302 (= Y310), R351 (= R359), D418 (= D426)
3h0lA Structure of tRNA-dependent amidotransferase gatcab from aquifex aeolicus (see paper)
52% identity, 100% coverage: 1:484/485 of query aligns to 2:476/478 of 3h0lA
- active site: K72 (= K76), S147 (= S155), S148 (= S156), S166 (≠ T174), T168 (= T176), G169 (= G177), G170 (= G178), S171 (= S179), Q174 (= Q182)
- binding asparagine: G123 (= G127), S147 (= S155), G169 (= G177), G170 (= G178), S171 (= S179), Y302 (= Y310), R351 (= R359), D418 (= D426)
2f2aA Structure of tRNA-dependent amidotransferase gatcab complexed with gln (see paper)
50% identity, 98% coverage: 4:480/485 of query aligns to 6:479/485 of 2f2aA
- active site: K79 (= K76), S154 (= S155), S155 (= S156), S173 (≠ T174), T175 (= T176), G176 (= G177), G177 (= G178), S178 (= S179), Q181 (= Q182)
- binding glutamine: G130 (= G127), S154 (= S155), D174 (= D175), T175 (= T176), G176 (= G177), S178 (= S179), F206 (= F207), Y309 (= Y310), Y310 (= Y311), R358 (= R359), D425 (= D426)
2dqnA Structure of tRNA-dependent amidotransferase gatcab complexed with asn (see paper)
50% identity, 98% coverage: 4:480/485 of query aligns to 6:479/485 of 2dqnA
- active site: K79 (= K76), S154 (= S155), S155 (= S156), S173 (≠ T174), T175 (= T176), G176 (= G177), G177 (= G178), S178 (= S179), Q181 (= Q182)
- binding asparagine: M129 (= M126), G130 (= G127), T175 (= T176), G176 (= G177), S178 (= S179), Y309 (= Y310), Y310 (= Y311), R358 (= R359), D425 (= D426)
3kfuE Crystal structure of the transamidosome (see paper)
48% identity, 98% coverage: 8:484/485 of query aligns to 4:465/468 of 3kfuE
4n0iA Crystal structure of s. Cerevisiae mitochondrial gatfab in complex with glutamine (see paper)
35% identity, 92% coverage: 25:468/485 of query aligns to 3:444/450 of 4n0iA
- active site: K38 (= K76), S116 (= S155), S117 (= S156), T135 (= T174), T137 (= T176), G138 (= G177), G139 (= G178), S140 (= S179), L143 (≠ Q182)
- binding glutamine: G89 (= G127), T137 (= T176), G138 (= G177), S140 (= S179), Y168 (≠ F207), Y271 (= Y310), Y272 (= Y311), R320 (= R359), D404 (= D426)
6c6gA An unexpected vestigial protein complex reveals the evolutionary origins of an s-triazine catabolic enzyme. Inhibitor bound complex. (see paper)
35% identity, 96% coverage: 8:474/485 of query aligns to 5:448/457 of 6c6gA
1m21A Crystal structure analysis of the peptide amidase pam in complex with the competitive inhibitor chymostatin (see paper)
35% identity, 99% coverage: 6:484/485 of query aligns to 8:484/487 of 1m21A
- active site: K81 (= K76), S160 (= S155), S161 (= S156), T179 (= T174), T181 (= T176), D182 (≠ G177), G183 (= G178), S184 (= S179), C187 (≠ Q182)
- binding : A129 (= A125), N130 (≠ M126), F131 (≠ G127), C158 (≠ G153), G159 (= G154), S160 (= S155), S184 (= S179), C187 (≠ Q182), I212 (≠ F207), R318 (≠ Y311), L321 (≠ A314), L365 (≠ I360), F426 (≠ D418)
3a1iA Crystal structure of rhodococcus sp. N-771 amidase complexed with benzamide (see paper)
37% identity, 84% coverage: 69:476/485 of query aligns to 88:499/508 of 3a1iA
- active site: K95 (= K76), S170 (= S155), S171 (= S156), G189 (≠ T174), Q191 (≠ T176), G192 (= G177), G193 (= G178), A194 (≠ S179), I197 (≠ Q182)
- binding benzamide: F145 (≠ M126), S146 (≠ G127), G147 (≠ S128), Q191 (≠ T176), G192 (= G177), G193 (= G178), A194 (≠ S179), W327 (≠ Y310)
6diiH Structure of arabidopsis fatty acid amide hydrolase in complex with methyl linolenyl fluorophosphonate (see paper)
32% identity, 78% coverage: 101:476/485 of query aligns to 231:590/616 of 6diiH
- binding methyl-9Z,12Z,15Z-octadecatrienylphosphonofluoridate: G255 (≠ A125), T258 (≠ S128), S281 (= S155), G302 (≠ T176), G303 (= G177), S305 (= S179), S472 (≠ T364), I532 (≠ S417), M539 (≠ L424)
Sites not aligning to the query:
Q7XJJ7 Fatty acid amide hydrolase; AtFAAH; N-acylethanolamine amidohydrolase; EC 3.5.1.99 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
32% identity, 78% coverage: 101:476/485 of query aligns to 231:590/607 of Q7XJJ7
- SS 281:282 (= SS 155:156) mutation to AA: Loss of activity.
- GGGS 302:305 (≠ TGGS 176:179) binding
- S305 (= S179) mutation to A: Loss of activity.
- R307 (= R181) mutation to A: Loss of activity.
- S360 (≠ F234) mutation to A: No effect.
Sites not aligning to the query:
- 205 K→A: Loss of activity.
Q84DC4 Mandelamide hydrolase; EC 3.5.1.86 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
30% identity, 97% coverage: 5:476/485 of query aligns to 29:489/507 of Q84DC4
- T31 (≠ A7) mutation to I: More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with N-437.
- K100 (= K76) mutation to A: Abolishes activity on mandelamide.
- S180 (= S155) mutation to A: Significantly decreases activity on mandelamide.
- S181 (= S156) mutation to A: Significantly decreases activity on mandelamide.
- G202 (= G177) mutation to A: Increase in KM values for aromatic substrates, but not aliphatic substrates. Active against lactamide but not against mandelamide; when associated with H-207 and E-382.; mutation to V: Increase in KM values for aromatic substrates, but not aliphatic substrates.
- S204 (= S179) mutation to A: Abolishes activity on mandelamide.
- Q207 (= Q182) mutation to H: Increases activity on lactamide, does not affect activity on mandelamide; when associated with E-382. Active against lactamide but not against mandelamide; when associated with A-202 and E-382. More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with S-316 and N-437.
- S316 (≠ A306) mutation to N: More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with H-207 and N-437.
- Q382 (≠ D373) mutation to H: Increases activity on lactamide, does not affect activity on mandelamide; when associated with H-207. Active against lactamide but not against mandelamide; when associated with A-202 and H-207.
- I437 (≠ A431) mutation to N: More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers. More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with I-31. More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with H-207 and N-316.
4yjiA The crystal structure of a bacterial aryl acylamidase belonging to the amidase signature (as) enzymes family (see paper)
29% identity, 99% coverage: 1:481/485 of query aligns to 3:480/490 of 4yjiA
- active site: K79 (= K76), S158 (= S155), S159 (= S156), G179 (≠ T176), G180 (= G177), G181 (= G178), A182 (≠ S179)
- binding n-(4-hydroxyphenyl)acetamide (tylenol): L81 (≠ I78), G132 (≠ A125), S158 (= S155), G179 (≠ T176), G180 (= G177), A182 (≠ S179)
5h6sC Crystal structure of hydrazidase s179a mutant complexed with a substrate (see paper)
27% identity, 96% coverage: 8:475/485 of query aligns to 9:445/457 of 5h6sC
- active site: K77 (= K76), S152 (= S155), S153 (= S156), L173 (≠ T176), G174 (= G177), G175 (= G178), S176 (= S179)
- binding 4-oxidanylbenzohydrazide: C126 (≠ A125), R128 (≠ G127), W129 (≠ S128), S152 (= S155), L173 (≠ T176), G174 (= G177), S176 (= S179), W306 (≠ Y310), F338 (≠ V362)
4gysB Granulibacter bethesdensis allophanate hydrolase co-crystallized with malonate (see paper)
32% identity, 94% coverage: 22:475/485 of query aligns to 20:439/461 of 4gysB
- active site: K72 (= K76), S146 (= S155), S147 (= S156), T165 (= T174), T167 (= T176), A168 (≠ G177), G169 (= G178), S170 (= S179), V173 (≠ Q182)
- binding malonate ion: A120 (= A125), G122 (= G127), S146 (= S155), T167 (= T176), A168 (≠ G177), S170 (= S179), S193 (≠ Y202), G194 (= G203), V195 (≠ M204), R200 (≠ S209), Y297 (≠ F325), R305 (= R333)
Q936X2 Allophanate hydrolase; EC 3.5.1.54 from Pseudomonas sp. (strain ADP) (see paper)
29% identity, 94% coverage: 22:475/485 of query aligns to 37:462/605 of Q936X2
- K91 (= K76) mutation to A: Loss of activity.
- S165 (≠ G154) mutation to A: Loss of activity.
- S189 (= S179) mutation to A: Loss of activity.
1o9oA Crystal structure of the s131a mutant of malonamidase e2 complexed with malonamate from bradyrhizobium japonicum (see paper)
28% identity, 96% coverage: 5:470/485 of query aligns to 3:403/412 of 1o9oA
- active site: K62 (= K76), A131 (≠ S155), S132 (= S156), T150 (= T174), T152 (= T176), G153 (= G177), G154 (= G178), S155 (= S179), R158 (≠ Q182)
- binding 3-amino-3-oxopropanoic acid: G130 (= G154), T152 (= T176), G153 (= G177), G154 (= G178), S155 (= S179), R158 (≠ Q182), P359 (= P419)
1ocmA The crystal structure of malonamidase e2 covalently complexed with pyrophosphate from bradyrhizobium japonicum (see paper)
28% identity, 96% coverage: 5:470/485 of query aligns to 3:403/412 of 1ocmA
- active site: K62 (= K76), S131 (= S155), S132 (= S156), T152 (= T176), G153 (= G177), G154 (= G178), S155 (= S179)
- binding pyrophosphate 2-: R113 (≠ G127), S131 (= S155), Q151 (≠ D175), T152 (= T176), G153 (= G177), G154 (= G178), S155 (= S179), R158 (≠ Q182), P359 (= P419)
Q9FR37 Amidase 1; AtAMI1; Translocon at the outer membrane of chloroplasts 64-I; AtTOC64-I; EC 3.5.1.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 82% coverage: 70:468/485 of query aligns to 30:416/425 of Q9FR37
- K36 (= K76) active site, Charge relay system; mutation to A: Loss of catalytic activity.; mutation to R: Reduces catalytic activity 10-fold.
- S113 (= S155) active site, Charge relay system; mutation S->A,T: Loss of catalytic activity.
- S114 (= S156) mutation to A: Loss of catalytic activity.; mutation to T: Reduces catalytic activity 400-fold.
- D133 (= D175) mutation to A: Loss of catalytic activity.; mutation to E: Reduces catalytic activity 600-fold.
- S137 (= S179) active site, Acyl-ester intermediate; mutation to A: Reduces catalytic activity 170-fold.; mutation to T: Loss of catalytic activity.
- C145 (= C187) mutation C->A,S: Reduces catalytic activity 10-fold.
- S214 (≠ G263) mutation to T: Slightly reduces catalytic activity.
6te4A Structural insights into pseudomonas aeruginosa type six secretion system exported effector 8: tse8 in complex with a peptide (see paper)
32% identity, 50% coverage: 5:247/485 of query aligns to 6:252/564 of 6te4A
Sites not aligning to the query:
Query Sequence
>GFF2513 FitnessBrowser__Marino:GFF2513
MHNKSVAELSRELESGKISSVELTQEFLDRIKREDSKYNSFITVTEEQALADARVADEQR
AAGNATPWTGVPFAHKDIFCTNGVRTTCGSKMLENFVPPYDATVTANFREAGAVCLGKTN
MDEFAMGSSNENSYFGAVTNPWGLSEGNKRVPGGSSGGSAAAVAARLIPAATATDTGGSI
RQPAALCGVTGLKPTYGRVSRYGMIAFASSLDQGGTMARTAEDNALMLNVMAGFDPKDST
SIDREVPDYTATLNEPLKGLRIGLPREYFSDQLSPAMEQQVRNAVKEYEKLGATVKEVSL
PNAKLAIAAYYVIAPAEASANLSRFDGVRYGYRCENPKDLMDLYTRSRAEGFGEEVKRRI
LVGTYALSAGYFDAYYLKAQKVRRLIQQDFINAFKEVDVLMSPTTPSPAFIQGEKTSDPV
TMYLEDVFTIAINLAGVPAMSVPAGFVDGLPVGLQIIGDYFSEARLLNAAHQFQQVTDWH
QRKPQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory