SitesBLAST
Comparing GFF2520 FitnessBrowser__Phaeo:GFF2520 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
53% identity, 76% coverage: 5:269/350 of query aligns to 2:265/382 of 7ahhC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
7aheC Opua inhibited inward facing (see paper)
53% identity, 76% coverage: 5:269/350 of query aligns to 2:265/382 of 7aheC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
7ahdC Opua (e190q) occluded (see paper)
52% identity, 74% coverage: 5:264/350 of query aligns to 2:260/260 of 7ahdC
- binding adenosine-5'-triphosphate: F12 (= F15), T39 (≠ V43), S61 (= S65), G62 (= G66), G64 (= G68), K65 (= K69), S66 (= S70), T67 (= T71), Q111 (= Q115), K161 (≠ S165), Q162 (= Q166), S164 (= S168), G166 (= G170), M167 (= M171), Q188 (≠ E192), H221 (= H225)
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
41% identity, 75% coverage: 6:267/350 of query aligns to 3:236/241 of 4u00A
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 74% coverage: 13:271/350 of query aligns to 5:252/378 of P69874
- C26 (≠ S34) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (≠ Q35) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (≠ I58) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (≠ S67) mutation to T: Loss of ATPase activity and transport.
- L60 (≠ I73) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (= L89) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V154) mutation to M: Loss of ATPase activity and transport.
- D172 (= D191) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
37% identity, 64% coverage: 46:270/350 of query aligns to 17:239/240 of 4ymuJ
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
36% identity, 64% coverage: 45:267/350 of query aligns to 20:241/343 of P30750
- 40:46 (vs. 65:71, 86% identical) binding
- E166 (= E192) mutation to Q: Exhibits little ATPase activity.
Sites not aligning to the query:
- 278:283 binding
- 295 N→A: Reduces the binding of L-methionine to undetectable levels.
- 295:296 binding
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
33% identity, 68% coverage: 30:268/350 of query aligns to 3:244/375 of 2d62A
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
36% identity, 64% coverage: 45:267/350 of query aligns to 21:242/344 of 6cvlD
- binding phosphothiophosphoric acid-adenylate ester: S41 (= S65), G42 (= G66), A43 (≠ S67), G44 (= G68), K45 (= K69), S46 (= S70), T47 (= T71), N141 (≠ Q166), S143 (= S168), Q146 (≠ M171), H200 (= H225)
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
36% identity, 64% coverage: 45:267/350 of query aligns to 21:242/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
36% identity, 64% coverage: 45:267/350 of query aligns to 21:242/344 of 3tuiC
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
39% identity, 64% coverage: 46:270/350 of query aligns to 19:241/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
39% identity, 64% coverage: 46:270/350 of query aligns to 19:241/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
39% identity, 64% coverage: 46:270/350 of query aligns to 19:241/242 of 2olkA
Sites not aligning to the query:
2oljA Abc protein artp in complex with adp/mg2+
39% identity, 64% coverage: 46:270/350 of query aligns to 19:241/242 of 2oljA
Sites not aligning to the query:
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
36% identity, 64% coverage: 47:269/350 of query aligns to 20:236/371 of P68187
- A85 (= A118) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ D139) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ A147) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ W150) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ D152) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ S157) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G170) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D191) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
- R228 (≠ P261) mutation to C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
Sites not aligning to the query:
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
36% identity, 64% coverage: 47:269/350 of query aligns to 19:235/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: S37 (= S65), G38 (= G66), C39 (≠ S67), G40 (= G68), K41 (= K69), S42 (= S70), T43 (= T71), Q81 (= Q115), R128 (= R162), A132 (≠ Q166), S134 (= S168), G136 (= G170), Q137 (≠ M171), E158 (= E192), H191 (= H225)
- binding magnesium ion: S42 (= S70), Q81 (= Q115)
Sites not aligning to the query:
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
36% identity, 64% coverage: 47:269/350 of query aligns to 19:235/371 of 3puxA
- binding adenosine-5'-diphosphate: G38 (= G66), C39 (≠ S67), G40 (= G68), K41 (= K69), S42 (= S70), T43 (= T71), R128 (= R162), S134 (= S168), Q137 (≠ M171)
- binding beryllium trifluoride ion: S37 (= S65), G38 (= G66), K41 (= K69), Q81 (= Q115), S134 (= S168), G136 (= G170), H191 (= H225)
- binding magnesium ion: S42 (= S70), Q81 (= Q115)
Sites not aligning to the query:
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
36% identity, 64% coverage: 47:269/350 of query aligns to 19:235/371 of 3puwA
- binding adenosine-5'-diphosphate: G38 (= G66), C39 (≠ S67), G40 (= G68), K41 (= K69), S42 (= S70), T43 (= T71), R128 (= R162), A132 (≠ Q166), S134 (= S168), Q137 (≠ M171)
- binding tetrafluoroaluminate ion: S37 (= S65), G38 (= G66), K41 (= K69), Q81 (= Q115), S134 (= S168), G135 (= G169), G136 (= G170), E158 (= E192), H191 (= H225)
- binding magnesium ion: S42 (= S70), Q81 (= Q115)
Sites not aligning to the query:
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
36% identity, 64% coverage: 47:269/350 of query aligns to 19:235/371 of 3puvA
- binding adenosine-5'-diphosphate: G38 (= G66), C39 (≠ S67), G40 (= G68), K41 (= K69), S42 (= S70), T43 (= T71), R128 (= R162), A132 (≠ Q166), S134 (= S168), Q137 (≠ M171)
- binding magnesium ion: S42 (= S70), Q81 (= Q115)
Sites not aligning to the query:
Query Sequence
>GFF2520 FitnessBrowser__Phaeo:GFF2520
MNTTKIQIRNLYKIFGANPGTVLPMVRNQGMGKSQLLEEHKHVLGLQDISIDIQAGEISV
IMGLSGSGKSTLIRHLNRLIEPTAGEILLDGQDVMDLDPVQLREMRQRSMSMVFQKFALL
PHKTVLENAETALRVRGDDRATCEAAARKWLDRVGLSGFENRYPSQLSGGMQQRVGIARA
LTADTDIMLLDEAFSALDPLIRTDMQDLLLELQTELHKTIVFITHDLDEALKLADHLVIL
KDGAVVQQGPPQGIVMNPADPYIEAFVGDINRARVLRAGTIAVTGEPEGRLAGEVDWQDT
LETVIKKAGGRADVSVSVLRDGQVAGKIEMSELMLALVPYDSQTNNSSGF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory