SitesBLAST
Comparing GFF2535 FitnessBrowser__Phaeo:GFF2535 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7vw6B Cryo-em structure of formate dehydrogenase 1 from methylorubrum extorquens am1 (see paper)
60% identity, 95% coverage: 28:574/576 of query aligns to 12:556/560 of 7vw6B
- binding fe2/s2 (inorganic) cluster: C108 (= C124), T112 (≠ S128), C113 (= C129), C141 (= C157), L144 (≠ R160), C145 (= C161)
- binding flavin mononucleotide: G221 (= G236), G223 (= G238), K232 (= K247), N248 (= N263), D250 (= D265), Y324 (= Y343), G327 (= G346), E328 (= E347), N363 (≠ H382), N364 (= N383), T367 (= T386)
- binding iron/sulfur cluster: I325 (= I344), P343 (= P362), S496 (= S514), C497 (= C515), G498 (= G516), Q499 (= Q517), C500 (= C518), C503 (= C521), I536 (= I554), C537 (= C555), L539 (= L557), G540 (= G558)
7p8nB Tmhydabc- t. Maritima hydrogenase with bridge closed (see paper)
36% identity, 79% coverage: 119:575/576 of query aligns to 26:540/613 of 7p8nB
- binding fe2/s2 (inorganic) cluster: C31 (= C124), G33 (≠ S126), T34 (≠ L127), C36 (= C129), C67 (= C157), C68 (≠ M158), G69 (= G159), R70 (= R160), C71 (= C161)
- binding flavin mononucleotide: G185 (= G236), R186 (≠ L237), G187 (= G238), N213 (= N263), D215 (= D265), E216 (= E266), G217 (= G267), F301 (≠ Y343), G304 (= G346), E305 (= E347), E306 (= E348), N340 (≠ H382), N341 (= N383), G521 (= G556), L522 (= L557)
- binding iron/sulfur cluster: P320 (= P362), S473 (= S514), C474 (= C515), G475 (= G516), K476 (≠ Q517), C477 (= C518), C480 (= C521), L519 (≠ I554), C520 (= C555), L522 (= L557), G523 (= G558)
- binding zinc ion: C457 (≠ S498)
Sites not aligning to the query:
- binding iron/sulfur cluster: 560, 567, 570, 571, 573, 577, 590, 592, 597, 599, 600, 601, 603, 607
- binding zinc ion: 544, 549, 554
6saqB Wild-type nuoef from aquifex aeolicus bound to nadh-oh (see paper)
42% identity, 67% coverage: 192:575/576 of query aligns to 21:412/419 of 6saqB
- binding flavin mononucleotide: G64 (= G236), G66 (= G238), K75 (= K247), N91 (= N263), D93 (= D265), E94 (= E266), Y179 (= Y343), G182 (= G346), E183 (= E347), N218 (≠ H382), N219 (= N383), T222 (= T386)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2~{R},3~{S},4~{R},5~{R})-5-[[(1~{E},3~{Z})-5-azanyl-4-oxidanyl-5-oxidanylidene-penta-1,3-dienyl]-methanoyl-amino]-3,4-bis(oxidanyl)oxolan-2-yl]methyl hydrogen phosphate: G66 (= G238), G67 (= G239), A68 (= A240), F70 (= F242), K75 (= K247), E94 (= E266), E96 (= E268), T99 (= T271), E184 (= E348), Y204 (≠ F368), T318 (≠ S487)
- binding iron/sulfur cluster: P198 (= P362), T345 (≠ S514), C346 (= C515), G347 (= G516), Q348 (= Q517), C349 (= C518), C352 (= C521), I391 (= I554), C392 (= C555), G395 (= G558)
6q9cB Crystal structure of aquifex aeolicus nadh-quinone oxidoreductase subunits nuoe and nuof bound to nadh under anaerobic conditions (see paper)
42% identity, 67% coverage: 192:575/576 of query aligns to 21:412/418 of 6q9cB
- binding flavin mononucleotide: G64 (= G236), G66 (= G238), K75 (= K247), N91 (= N263), D93 (= D265), E94 (= E266), G182 (= G346), E183 (= E347), E184 (= E348), V217 (= V381), N218 (≠ H382), N219 (= N383), T222 (= T386), G393 (= G556)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G66 (= G238), G67 (= G239), A68 (= A240), F70 (= F242), K75 (= K247), E94 (= E266), E96 (= E268), Y179 (= Y343), E184 (= E348), Y204 (≠ F368)
- binding iron/sulfur cluster: P198 (= P362), T345 (≠ S514), C346 (= C515), G347 (= G516), Q348 (= Q517), C349 (= C518), C352 (= C521), I391 (= I554), C392 (= C555), L394 (= L557), G395 (= G558)
7q5yC Structure of nadh:ubichinon oxidoreductase (complex i) of the hyperthermophilic eubacterium aquifex aeolicus
42% identity, 67% coverage: 192:575/576 of query aligns to 22:413/419 of 7q5yC
- binding flavin mononucleotide: G65 (= G236), G67 (= G238), K76 (= K247), N92 (= N263), E95 (= E266), Y180 (= Y343), G183 (= G346), E184 (= E347), V218 (= V381), N219 (≠ H382), N220 (= N383), T223 (= T386)
- binding iron/sulfur cluster: T346 (≠ S514), C347 (= C515), G348 (= G516), Q349 (= Q517), C350 (= C518), C353 (= C521), S391 (= S553), I392 (= I554), C393 (= C555), G396 (= G558)
6hl3B Wild-type nuoef from aquifex aeolicus - oxidized form bound to NAD+ (see paper)
42% identity, 67% coverage: 192:575/576 of query aligns to 20:411/416 of 6hl3B
- binding flavin mononucleotide: G63 (= G236), G65 (= G238), K74 (= K247), N90 (= N263), D92 (= D265), E93 (= E266), G181 (= G346), E182 (= E347), E183 (= E348), V216 (= V381), N217 (≠ H382), N218 (= N383), T221 (= T386)
- binding nicotinamide-adenine-dinucleotide: G65 (= G238), G66 (= G239), A67 (= A240), F69 (= F242), K74 (= K247), E95 (= E268), Y178 (= Y343), E183 (= E348), K200 (≠ R365), Y203 (≠ F368)
- binding iron/sulfur cluster: I179 (= I344), P197 (= P362), T344 (≠ S514), C345 (= C515), G346 (= G516), Q347 (= Q517), C348 (= C518), C351 (= C521), S389 (= S553), I390 (= I554), C391 (= C555), L393 (= L557), G394 (= G558)
7q4vB Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
36% identity, 79% coverage: 121:575/576 of query aligns to 8:523/599 of 7q4vB
- binding fe2/s2 (inorganic) cluster: C11 (= C124), C16 (= C129), C48 (= C157), F49 (≠ M158), L51 (≠ R160), C52 (= C161)
- binding flavin mononucleotide: G166 (= G236), G168 (= G238), N196 (= N263), D198 (= D265), F284 (≠ Y343), G287 (= G346), E288 (= E347), E289 (= E348), N324 (= N383)
- binding iron/sulfur cluster: C457 (= C515), G458 (= G516), K459 (≠ Q517), C460 (= C518), C463 (= C521), C503 (= C555), G506 (= G558)
- binding zinc ion: C440 (≠ S498)
Sites not aligning to the query:
- binding iron/sulfur cluster: 544, 551, 552, 553, 554, 555, 556, 557, 561, 562, 574, 581, 583, 584, 585, 586, 587, 591, 593, 595
- binding zinc ion: 527, 533
8a6tB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
40% identity, 65% coverage: 204:575/576 of query aligns to 168:554/630 of 8a6tB
- binding flavin mononucleotide: G201 (= G238), N227 (= N263), E230 (= E266), N355 (= N383), G535 (= G556), L536 (= L557)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S320 (≠ E348), R337 (= R365), R340 (≠ F368), T341 (≠ V369), N342 (≠ A370), S433 (= S460)
- binding iron/sulfur cluster: S487 (= S514), C488 (= C515), G489 (= G516), C491 (= C518), C494 (= C521), C534 (= C555), L536 (= L557), G537 (= G558)
- binding zinc ion: C471 (≠ S498)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 31, 33, 36, 82, 85, 86
- binding iron/sulfur cluster: 575, 577, 582, 583, 585, 588, 592, 596, 597, 607, 612, 618, 622, 624, 626, 627
- binding zinc ion: 558, 564
7q4vF Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
42% identity, 64% coverage: 209:575/576 of query aligns to 10:394/470 of 7q4vF
- binding flavin mononucleotide: G37 (= G236), G39 (= G238), N67 (= N263), G158 (= G346), E159 (= E347), E160 (= E348), G375 (= G556)
- binding nicotinamide-adenine-dinucleotide: G40 (= G239), F43 (= F242), K48 (= K247), R177 (= R365), F180 (= F368), M297 (≠ F484)
- binding iron/sulfur cluster: S327 (= S514), C328 (= C515), G329 (= G516), K330 (≠ Q517), C331 (= C518), C334 (= C521), L373 (≠ I554), C374 (= C555)
- binding zinc ion: C311 (≠ S498)
Sites not aligning to the query:
- binding iron/sulfur cluster: 415, 417, 422, 424, 425, 426, 427, 428, 432, 433, 437, 445, 452, 454, 455, 456, 457, 458, 462, 463, 467
- binding zinc ion: 398, 404, 409
8a5eB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from acetobacterium woodii in the reduced state (see paper)
42% identity, 58% coverage: 242:575/576 of query aligns to 20:371/447 of 8a5eB
- binding flavin mononucleotide: N44 (= N263), G135 (= G346), E137 (= E348), N171 (≠ H382), N172 (= N383), G352 (= G556)
- binding 1,4-dihydronicotinamide adenine dinucleotide: F20 (= F242), K25 (= K247), F28 (= F250), D49 (≠ E268), R154 (= R365), F157 (= F368), S250 (= S460)
- binding iron/sulfur cluster: P151 (= P362), C305 (= C515), G306 (= G516), K307 (≠ Q517), C308 (= C518), C311 (= C521), C351 (= C555), G354 (= G558)
- binding zinc ion: C288 (≠ S498)
Sites not aligning to the query:
- binding flavin mononucleotide: 14, 16
- binding 1,4-dihydronicotinamide adenine dinucleotide: 16, 17
- binding iron/sulfur cluster: 392, 399, 401, 402, 403, 405, 409, 410, 414, 429, 431, 432, 433, 435, 439, 440, 444
- binding zinc ion: 375, 381, 386
7t30B Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/NAD(h) bound state (see paper)
41% identity, 65% coverage: 199:575/576 of query aligns to 17:409/425 of 7t30B
- binding fe2/s2 (inorganic) cluster: C326 (≠ S498), C364 (vs. gap)
- binding flavin mononucleotide: G54 (= G236), G56 (= G238), K65 (= K247), N82 (= N263), D84 (= D265), E85 (= E266), G173 (= G346), E175 (= E348), N210 (= N383), G390 (= G556), L391 (= L557)
- binding nicotinamide-adenine-dinucleotide: G56 (= G238), G57 (= G239), A58 (= A240), F60 (= F242), K65 (= K247), F68 (= F250), E85 (= E266), E175 (= E348), R192 (= R365), F195 (= F368), I312 (≠ F484), M313 (≠ I485), S315 (= S487)
- binding iron/sulfur cluster: S342 (= S514), C343 (= C515), G344 (= G516), C346 (= C518), C349 (= C521), S387 (= S553), C389 (= C555), L391 (= L557), G392 (= G558)
Sites not aligning to the query:
7t2rB Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn-free apo state (see paper)
41% identity, 65% coverage: 199:575/576 of query aligns to 17:409/425 of 7t2rB
Sites not aligning to the query:
Q56222 NADH-quinone oxidoreductase subunit 1; NADH dehydrogenase I chain 1; NDH-1 subunit 1; EC 7.1.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
39% identity, 65% coverage: 200:575/576 of query aligns to 28:420/438 of Q56222
4hea1 Crystal structure of the entire respiratory complex i from thermus thermophilus (see paper)
39% identity, 65% coverage: 200:575/576 of query aligns to 27:419/437 of 4hea1
- binding flavin mononucleotide: G63 (= G236), K74 (= K247), N91 (= N263), D93 (= D265), Y179 (= Y343), G182 (= G346), E183 (= E347), N218 (≠ H382), N219 (= N383), L401 (= L557)
- binding iron/sulfur cluster: I180 (= I344), P198 (= P362), S351 (= S514), C352 (= C515), G353 (= G516), K354 (≠ Q517), C355 (= C518), C358 (= C521), F398 (≠ I554), C399 (= C555), L401 (= L557)
2ybb1 Fitted model for bovine mitochondrial supercomplex i1iii2iv1 by single particle cryo-em (emd-1876) (see paper)
39% identity, 65% coverage: 200:575/576 of query aligns to 27:419/437 of 2ybb1
- binding flavin mononucleotide: G63 (= G236), G65 (= G238), N91 (= N263), D93 (= D265), G182 (= G346), E183 (= E347), E184 (= E348), N218 (≠ H382), N219 (= N383), T222 (= T386), P400 (≠ G556)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G65 (= G238), G66 (= G239), F69 (= F242), K74 (= K247), F77 (= F250), E96 (= E268), Y179 (= Y343), E184 (= E348), K201 (≠ R365), F204 (= F368), T324 (≠ S487)
- binding iron/sulfur cluster: S351 (= S514), C352 (= C515), K354 (≠ Q517), C355 (= C518), C358 (= C521), F398 (≠ I554), C399 (= C555), L401 (= L557), A402 (≠ G558)
7p61F Complex i from e. Coli, ddm-purified, with nadh, resting state (see paper)
39% identity, 65% coverage: 204:576/576 of query aligns to 29:419/442 of 7p61F
- binding flavin mononucleotide: G61 (= G236), G63 (= G238), K72 (= K247), N90 (= N263), D92 (= D265), G181 (= G346), E182 (= E347), N217 (≠ H382), N218 (= N383), A399 (≠ G556), H400 (≠ L557)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G63 (= G238), G64 (= G239), A65 (= A240), F67 (= F242), K72 (= K247), L75 (≠ F250), E95 (= E268), Y178 (= Y343), E183 (= E348), F203 (= F368), R320 (≠ F484), T323 (≠ S487)
- binding iron/sulfur cluster: S350 (= S514), C351 (= C515), W353 (≠ Q517), C354 (= C518), C357 (= C521), F397 (≠ I554), C398 (= C555), H400 (≠ L557)
8oh5B Cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) (see paper)
38% identity, 65% coverage: 199:575/576 of query aligns to 116:508/584 of 8oh5B
- binding flavin mononucleotide: R154 (≠ L237), K164 (= K247), N181 (= N263), F269 (≠ Y343), E273 (= E347), E274 (= E348), I307 (≠ V381), N308 (≠ H382), N309 (= N383), G489 (= G556), L490 (= L557)
- binding nicotinamide-adenine-dinucleotide: G155 (= G238), G156 (= G239), F159 (= F242), F163 (≠ T246), E273 (= E347), E274 (= E348), K291 (≠ R365), F294 (= F368), G413 (= G486)
- binding iron/sulfur cluster: P288 (= P362), C442 (= C515), G443 (= G516), C445 (= C518), C448 (= C521), C488 (= C555), L490 (= L557), G491 (= G558)
- binding zinc ion: C425 (≠ S498)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 10, 41, 45
- binding iron/sulfur cluster: 531, 536, 540, 542, 546, 547, 548, 559, 566, 567, 568, 569, 572
- binding zinc ion: 512, 518, 523
7o6yB Cryo-em structure of respiratory complex i under turnover (see paper)
38% identity, 65% coverage: 201:576/576 of query aligns to 23:419/457 of 7o6yB
- binding flavin mononucleotide: G57 (= G236), G59 (= G238), K68 (= K247), N89 (= N263), D91 (= D265), E92 (= E266), G180 (= G346), E181 (= E347), E182 (= E348), T216 (≠ H382), N217 (= N383)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G59 (= G238), G60 (= G239), F63 (= F242), K68 (= K247), E94 (= E268), Y177 (= Y343), E182 (= E348), F202 (= F368), T324 (≠ S487)
- binding iron/sulfur cluster: P196 (= P362), S351 (= S514), C352 (= C515), G353 (= G516), Q354 (= Q517), C355 (= C518), C358 (= C521), T396 (≠ S553), C398 (= C555), L400 (= L557)
7b0nF 3.7-angstrom structure of Yarrowia lipolytica complex I with an R121M mutation in NUCM. (see paper)
38% identity, 65% coverage: 201:576/576 of query aligns to 24:420/460 of 7b0nF
- binding flavin mononucleotide: G60 (= G238), K69 (= K247), N90 (= N263), D92 (= D265), E93 (= E266), G94 (= G267), Y178 (= Y343), G181 (= G346), E182 (= E347), N218 (= N383)
- binding iron/sulfur cluster: P197 (= P362), S352 (= S514), C353 (= C515), Q355 (= Q517), C356 (= C518), C359 (= C521), T397 (≠ S553), C399 (= C555)
7zm7B Cryoem structure of mitochondrial complex i from chaetomium thermophilum (inhibited by ddm) (see paper)
39% identity, 64% coverage: 210:576/576 of query aligns to 35:421/456 of 7zm7B
- binding flavin mononucleotide: G59 (= G236), G61 (= G238), K70 (= K247), N91 (= N263), D93 (= D265), G182 (= G346), E183 (= E347), E184 (= E348), A218 (≠ H382), N219 (= N383), A401 (≠ G556), L402 (= L557)
- binding iron/sulfur cluster: P198 (= P362), C354 (= C515), G355 (= G516), Q356 (= Q517), C357 (= C518), C360 (= C521), T398 (≠ S553), C400 (= C555), L402 (= L557)
Query Sequence
>GFF2535 FitnessBrowser__Phaeo:GFF2535
MECRLNWRREVEVIVAPLDNSKGVWKSGKGKGRKTPKGRQLEDQAHSEVLDLIGDQPRNR
DLLIEFLHLIQDKYGCLSAAHIRALAEELRTGQAEIYEVASFYAHFDVVREGETPPPALT
IRVCDSLSCELAGAEALQKALEDGLDASQVRVLRAPCMGRCDTAPVLEIGHNHIDHATPE
KVQAAIAADDTHAHIPAYETFAAYEADGGYATLKDLRANGDWEAVQAKVKEAGLRGLGGA
GFPSGTKWGFVRANEGPRYLAVNGDEGEPGTFKDRYYLERTPHVFLEGMLIAAWAVEAEK
AFIYMRDEYPAVLEILRREITALEEAGIVEAGYIDLRRGAGAYICGEESAMIESIEGKRG
EPRHRPPFVAQVGIFGRPTLVHNVETLYWVCKVNREGPECLNSVEKNGRKGLRSYSVSGR
VKNPGVHLLPAGSTITDIIEACGGMLDGHAFKAYQPGGPSSGLLPASMHDIPLDFDTLQP
HGTFIGSAAVVVLSDKDSARDAALNMLRFFEDESCGQCTPCRVGCEKAVKLMGEKKWDQG
LLEELSAAMVDTSICGLGQAAPNPIRLTIKHFPEEV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory