Comparing GFF2544 FitnessBrowser__Marino:GFF2544 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
3dmeA Crystal structure of conserved exported protein from bordetella pertussis. Northeast structural genomics target ber141
51% identity, 98% coverage: 7:369/369 of query aligns to 2:366/366 of 3dmeA
8w7fB Structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase bound with fad and a sulfate ion (see paper)
30% identity, 90% coverage: 32:364/369 of query aligns to 29:401/412 of 8w7fB
Sites not aligning to the query:
8w78A Structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase in complex with fad and 2-oxoglutarate (see paper)
30% identity, 90% coverage: 32:364/369 of query aligns to 29:399/410 of 8w78A
Sites not aligning to the query:
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
25% identity, 60% coverage: 9:228/369 of query aligns to 51:269/866 of Q9UI17
Sites not aligning to the query:
>GFF2544 FitnessBrowser__Marino:GFF2544
MHQENFETQTVVIGAGVIGLAIARALARAGHEVIVLESSDRFGEGISSRNSEVVHAGIYY
PQGSLKAELCVEGRQQLYDYCLTHKVGHRKCGKWIVAVDEAQNDKLCDIKAAAASNGVEL
EFYDGERVAQGVPGICASSGLWSPETGIVDSHGLMLSLLGELHDAGGQLALRSPVAAAES
DSQRHRLNVAGETPLILEAKNVINAAGLGAVPLAKNWAGLPDDCIPRQWFARGVYFSYSG
RTPFRTLIYPVPEPGGLGIHLTLDLAGQARFGPDVEWIEKEDYTVEPSRQEGFARGIRQW
WPGLDPTRLQPAYAGIRPKLIGPDGGFADFRIDGPETHGLPGLVNLFGIESPGLTSCLAI
AERVKALLS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory