SitesBLAST
Comparing GFF2551 FitnessBrowser__Phaeo:GFF2551 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
43% identity, 90% coverage: 21:255/260 of query aligns to 26:260/265 of P07821
- K50 (= K45) mutation to Q: Lack of activity.
- D172 (= D167) mutation to E: Lack of activity.
- E173 (= E168) mutation to A: Lack of activity.
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
32% identity, 85% coverage: 11:231/260 of query aligns to 6:224/240 of 4ymuJ
- binding adenosine-5'-triphosphate: F11 (≠ Y16), V16 (= V21), S36 (≠ N41), G37 (≠ A42), S38 (≠ C43), G39 (= G44), K40 (= K45), S41 (= S46), T42 (= T47), E162 (= E168), H194 (= H201)
- binding magnesium ion: S41 (= S46), E162 (= E168)
3c4jA Abc protein artp in complex with atp-gamma-s
30% identity, 88% coverage: 12:240/260 of query aligns to 9:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
30% identity, 88% coverage: 12:240/260 of query aligns to 9:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
30% identity, 88% coverage: 12:240/260 of query aligns to 9:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
30% identity, 88% coverage: 12:240/260 of query aligns to 9:242/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 87% coverage: 7:232/260 of query aligns to 3:225/241 of 4u00A
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
29% identity, 87% coverage: 5:230/260 of query aligns to 2:221/371 of P68187
- A85 (= A83) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ L112) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ A120) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (= V123) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ R125) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ T130) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G146) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D167) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
29% identity, 87% coverage: 5:230/260 of query aligns to 1:220/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ Y16), S37 (≠ N41), G38 (≠ A42), C39 (= C43), G40 (= G44), K41 (= K45), S42 (= S46), T43 (= T47), Q81 (= Q80), R128 (= R138), A132 (= A142), S134 (= S144), G136 (= G146), Q137 (= Q147), E158 (= E168), H191 (= H201)
- binding magnesium ion: S42 (= S46), Q81 (= Q80)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
29% identity, 87% coverage: 5:230/260 of query aligns to 1:220/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ Y16), G38 (≠ A42), C39 (= C43), G40 (= G44), K41 (= K45), S42 (= S46), T43 (= T47), R128 (= R138), S134 (= S144), Q137 (= Q147)
- binding beryllium trifluoride ion: S37 (≠ N41), G38 (≠ A42), K41 (= K45), Q81 (= Q80), S134 (= S144), G136 (= G146), H191 (= H201)
- binding magnesium ion: S42 (= S46), Q81 (= Q80)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
29% identity, 87% coverage: 5:230/260 of query aligns to 1:220/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ Y16), V17 (= V21), G38 (≠ A42), C39 (= C43), G40 (= G44), K41 (= K45), S42 (= S46), T43 (= T47), R128 (= R138), A132 (= A142), S134 (= S144), Q137 (= Q147)
- binding tetrafluoroaluminate ion: S37 (≠ N41), G38 (≠ A42), K41 (= K45), Q81 (= Q80), S134 (= S144), G135 (= G145), G136 (= G146), E158 (= E168), H191 (= H201)
- binding magnesium ion: S42 (= S46), Q81 (= Q80)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
29% identity, 87% coverage: 5:230/260 of query aligns to 1:220/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ Y16), V17 (= V21), G38 (≠ A42), C39 (= C43), G40 (= G44), K41 (= K45), S42 (= S46), T43 (= T47), R128 (= R138), A132 (= A142), S134 (= S144), Q137 (= Q147)
- binding magnesium ion: S42 (= S46), Q81 (= Q80)
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
29% identity, 87% coverage: 5:230/260 of query aligns to 1:220/374 of 2awnB
Q5M243 Energy-coupling factor transporter ATP-binding protein EcfA1; ECF transporter A component EcfA1; EC 7.-.-.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
29% identity, 88% coverage: 7:234/260 of query aligns to 2:228/276 of Q5M243
- Q90 (≠ A91) mutation to A: No effect on ATPase, 10-fold decrease in riboflavin uptake; when associated with A-97 in EcfA2.
- E163 (= E168) mutation to Q: 10-fold decrease in ATPase and riboflavin uptake; when associated with Q-171 in EcfA2.
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
30% identity, 85% coverage: 10:230/260 of query aligns to 4:218/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ Y16), S35 (≠ N41), G36 (≠ A42), C37 (= C43), G38 (= G44), K39 (= K45), S40 (= S46), T41 (= T47), R126 (= R138), A130 (= A142), S132 (= S144), G134 (= G146), Q135 (= Q147)
P0AAH0 Phosphate import ATP-binding protein PstB; ABC phosphate transporter; Phosphate-transporting ATPase; EC 7.3.2.1 from Escherichia coli (strain K12) (see paper)
28% identity, 89% coverage: 3:233/260 of query aligns to 7:242/257 of P0AAH0
- G48 (= G44) mutation to I: Loss of phosphate transport.
- K49 (= K45) mutation to Q: Loss of phosphate transport.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7mdyC Lolcde nucleotide-bound
33% identity, 84% coverage: 7:224/260 of query aligns to 3:223/226 of 7mdyC
- binding adp orthovanadate: Y12 (= Y16), G42 (≠ A42), S43 (≠ C43), G44 (= G44), K45 (= K45), S46 (= S46), T47 (= T47), Q91 (= Q87), H138 (= H135), E142 (= E141), S144 (= S144), G145 (= G145), G146 (= G146), E168 (= E168), N172 (≠ Y172), H201 (= H201)
- binding magnesium ion: S46 (= S46), Q91 (= Q87)
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
33% identity, 84% coverage: 7:224/260 of query aligns to 6:226/233 of P75957
- G42 (= G39) mutation to D: Loss of lipoprotein release when overexpressed.
3fvqB Crystal structure of the nucleotide binding domain fbpc complexed with atp (see paper)
35% identity, 87% coverage: 4:230/260 of query aligns to 1:225/350 of 3fvqB
- binding adenosine-5'-triphosphate: F13 (≠ Y16), Q14 (≠ S17), T16 (= T19), V18 (= V21), S38 (≠ N41), G39 (≠ A42), C40 (= C43), G41 (= G44), K42 (= K45), T43 (≠ S46), T44 (= T47), R133 (= R138), E137 (≠ A142), S139 (= S144), G141 (= G146), Q142 (= Q147)
- binding calcium ion: T43 (≠ S46), Q86 (= Q87)
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
30% identity, 88% coverage: 3:230/260 of query aligns to 2:221/369 of P19566
- L86 (≠ I84) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P169) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D174) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
Query Sequence
>GFF2551 FitnessBrowser__Phaeo:GFF2551
MAATARLRAEDLSVSYSRTPVLNSLSTDLPDGALTVIVGPNACGKSTLLRALARLQPAGK
GQVLLDGKAIHRQGSRAVAQRLAILPQTPTAPEGLTVRDLATRGRTPHQSPLRQWSRQDA
EAVTRALDLTHMAPHADRPLEALSGGQRQRAWIAMALAQDTDILLLDEPTTYLDLPHQIE
LLKLVQQLNRDTGRTVVMVLHDINLAARFASHMIALKDGQVFCEGPPDEVITEGVLQSVF
ALPCRIIADPVHGSPHVIPE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory