SitesBLAST
Comparing GFF2557 FitnessBrowser__WCS417:GFF2557 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3A Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
43% identity, 34% coverage: 767:1170/1175 of query aligns to 8:429/440 of 8gy3A
- binding heme c: Y52 (≠ D808), C53 (= C809), C56 (= C812), H57 (= H813), S84 (= S837), I86 (= I839), W97 (= W850), F102 (= F855), L117 (= L870), F121 (= F874), F126 (= F879), R163 (= R916), C203 (= C955), C206 (= C958), H207 (= H959), A232 (= A985), P233 (= P986), L235 (= L988), W245 (= W998), Y253 (= Y1006), L254 (= L1007), G263 (= G1016), S264 (≠ V1017), M269 (= M1022), Y292 (≠ L1044), C337 (= C1076), C340 (= C1079), H341 (= H1080), P353 (= P1093), L355 (≠ F1095), N358 (= N1098), N359 (≠ T1099), V372 (= V1112), I377 (= I1117), G382 (≠ T1122), Q383 (= Q1123), I386 (≠ G1126), M388 (= M1128), F391 (= F1131)
- binding ubiquinone-10: E55 (≠ V811), T76 (= T829), F78 (= F831), Y118 (= Y871), P119 (= P872), I160 (≠ F913), G166 (≠ M919), Q167 (≠ A920), F169 (vs. gap), W170 (= W922), H202 (= H954), R210 (= R962), L213 (≠ M965)
7w2jC Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
37% identity, 30% coverage: 797:1151/1175 of query aligns to 1:370/418 of 7w2jC
- binding heme c: C13 (= C809), C16 (= C812), H17 (= H813), T42 (≠ S837), I44 (= I839), Y55 (≠ W850), L75 (= L870), Y76 (= Y871), A78 (= A873), M79 (≠ F874), R122 (= R916), H161 (= H954), C162 (= C955), C165 (= C958), H166 (= H959), A191 (= A985), P192 (= P986), R223 (≠ V1017), P227 (= P1021), M228 (= M1022), V289 (≠ A1075), C290 (= C1076), C293 (= C1079), H294 (= H1080), Y305 (≠ V1091), Y306 (≠ S1092), P307 (= P1093), L309 (≠ F1095), N312 (= N1098), T313 (= T1099), T314 (≠ N1100), D322 (≠ N1108), I327 (= I1113), V331 (≠ I1117), R333 (≠ K1119), I340 (≠ G1126), M342 (= M1128), P343 (= P1129), F345 (= F1131)
8jejC Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
36% identity, 30% coverage: 797:1151/1175 of query aligns to 1:384/413 of 8jejC
- binding heme c: C13 (= C809), C16 (= C812), H17 (= H813), T42 (≠ S837), I44 (= I839), F60 (= F855), L64 (≠ M859), L75 (= L870), Y76 (= Y871), M79 (≠ F874), P80 (= P875), Y84 (≠ F879), R122 (= R916), C162 (= C955), C165 (= C958), H166 (= H959), I186 (≠ V980), W189 (= W983), A191 (= A985), P192 (= P986), I194 (≠ L988), W205 (= W998), Y213 (= Y1006), R223 (≠ V1017), M228 (= M1022), V303 (≠ A1075), C304 (= C1076), C307 (= C1079), H308 (= H1080), Y320 (≠ S1092), P321 (= P1093), L323 (≠ F1095), T327 (= T1099), T328 (≠ N1100), D336 (≠ N1108), I341 (= I1113), V345 (≠ I1117), R347 (≠ K1119), I354 (≠ G1126), M356 (= M1128), F359 (= F1131), I376 (≠ L1143)
- binding ubiquinone-10: M36 (≠ F831), P77 (= P872), S124 (≠ L918), W128 (= W922), C165 (= C958), L173 (≠ G966)
Sites not aligning to the query:
Q47945 Alcohol dehydrogenase (quinone), cytochrome c subunit; ADH; Alcohol dehydrogenase (quinone), subunit II; Cytochrome c-553; Cytochrome c553; Ethanol:Q2 reductase; G3-ADH subunit II; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 from Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) (see paper)
35% identity, 31% coverage: 794:1156/1175 of query aligns to 41:422/478 of Q47945
Sites not aligning to the query:
- 1:36 signal peptide
- 37 modified: Pyrrolidone carboxylic acid
8gy2B Cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans
35% identity, 31% coverage: 794:1156/1175 of query aligns to 3:384/433 of 8gy2B
- binding heme c: C18 (= C809), C21 (= C812), H22 (= H813), T46 (≠ S837), I48 (= I839), Y59 (≠ W850), L68 (≠ M859), R73 (≠ G864), V79 (≠ L870), Y80 (= Y871), M83 (≠ F874), F88 (= F879), R126 (= R916), H165 (= H954), C166 (= C955), C169 (= C958), H170 (= H959), I201 (≠ E984), A202 (= A985), P203 (= P986), L205 (= L988), W216 (= W998), F224 (≠ Y1006), A234 (≠ G1016), V235 (= V1017), F236 (≠ A1018), F236 (≠ A1018), M239 (≠ P1021), N301 (≠ A1075), C302 (= C1076), C305 (= C1079), H306 (= H1080), M316 (≠ L1088), F317 (= F1089), P318 (= P1093), L320 (≠ F1095), P324 (≠ T1099), G342 (≠ I1117), S352 (≠ Y1127), V354 (vs. gap), M356 (= M1128), F359 (= F1131), M375 (≠ L1147)
- binding ubiquinone-10: C21 (= C812), L34 (= L825), P39 (= P830), P81 (= P872), L129 (≠ M919), W132 (= W922), E168 (≠ A957), R173 (= R962), I197 (≠ V980), D241 (≠ G1023)
Sites not aligning to the query:
8gy3C Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
26% identity, 60% coverage: 43:744/1175 of query aligns to 16:731/732 of 8gy3C
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): M38 (≠ L65), G39 (= G66), Q40 (≠ T67), H41 (≠ G68), V42 (≠ I69), A45 (≠ S72), G79 (≠ I105), G80 (≠ A106), S81 (= S107), S83 (≠ T109), V84 (≠ L110), G374 (≠ C393), F375 (≠ Y394), L379 (≠ C398), L499 (≠ M514), R500 (= R515), V624 (≠ I636), D625 (≠ N637), Q632 (= Q644), T687 (≠ M700), G688 (= G701), L689 (≠ A702), G690 (= G703), E691 (= E704)
3hrdB Crystal structure of nicotinate dehydrogenase (see paper)
36% identity, 12% coverage: 604:742/1175 of query aligns to 183:327/330 of 3hrdB
- active site: E289 (= E704), P290 (≠ S705)
- binding pterin cytosine dinucleotide: I215 (= I636), N216 (= N637), M219 (≠ G640), V220 (= V641), Q223 (= Q644), K285 (vs. gap), G286 (vs. gap), V287 (vs. gap), G288 (= G703), E289 (= E704)
Sites not aligning to the query:
Q0QLF1 Nicotinate dehydrogenase medium molybdopterin subunit; NDH; Nicotinic acid hydroxylase medium molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
36% identity, 12% coverage: 604:742/1175 of query aligns to 183:327/330 of Q0QLF1
- 211:223 (vs. 632:644, 38% identical) binding
- AKGVGE 284:289 (≠ A---GE 702:704) binding
Sites not aligning to the query:
- 45:49 binding
- 85:90 binding
Q0QLF2 Nicotinate dehydrogenase large molybdopterin subunit; NDH; Nicotinic acid hydroxylase large molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see 2 papers)
24% identity, 31% coverage: 183:546/1175 of query aligns to 3:382/425 of Q0QLF2
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2:425 modified: mature protein, Nicotinate dehydrogenase large molybdopterin subunit
3hrdE Crystal structure of nicotinate dehydrogenase (see paper)
24% identity, 31% coverage: 183:546/1175 of query aligns to 2:381/420 of 3hrdE
- active site: Q207 (= Q363), L242 (≠ C398), R318 (≠ L469), H322 (≠ F482), R350 (= R515)
- binding calcium ion: T206 (≠ S362), N208 (= N364), D212 (≠ L368), K241 (≠ N397), L242 (≠ C398), D243 (≠ A399)
- binding pterin cytosine dinucleotide: G237 (≠ C393), F238 (≠ Y394), R350 (= R515)
- binding selenium atom: F238 (≠ Y394), A348 (≠ W513), F349 (≠ M514), R350 (= R515)
3hrdA Crystal structure of nicotinate dehydrogenase (see paper)
24% identity, 31% coverage: 183:546/1175 of query aligns to 2:381/420 of 3hrdA
- active site: Q207 (= Q363), L242 (≠ C398), R318 (≠ L469), H322 (≠ F482), R350 (= R515)
- binding pterin cytosine dinucleotide: G236 (= G392), G237 (≠ C393), F238 (≠ Y394), R350 (= R515)
- binding magnesium ion: T206 (≠ S362), N208 (= N364), D212 (≠ L368), K241 (≠ N397), L242 (≠ C398), D243 (≠ A399), T305 (vs. gap), Y308 (= Y459), A309 (≠ P460), S346 (≠ A511)
- binding nicotinic acid: A314 (≠ P465), R318 (≠ L469), F352 (≠ V517)
- binding selenium atom: F238 (≠ Y394), G239 (= G395), A348 (≠ W513), F349 (≠ M514), R350 (= R515)
5g5gC Escherichia coli periplasmic aldehyde oxidase (see paper)
24% identity, 35% coverage: 180:589/1175 of query aligns to 10:436/731 of 5g5gC
Sites not aligning to the query:
- active site: 692, 693
- binding pterin cytosine dinucleotide: 468, 469, 470, 507, 509, 511, 512, 617, 618, 621, 625, 688, 690, 691, 692
P77489 Aldehyde oxidoreductase molybdenum-binding subunit PaoC; EC 1.2.99.6 from Escherichia coli (strain K12) (see 2 papers)
24% identity, 35% coverage: 180:589/1175 of query aligns to 10:436/732 of P77489
Sites not aligning to the query:
- 440 mutation R->H,K: Decrease in catalytic efficiency.
- 468:470 binding
- 511:512 binding
- 615:621 binding
- 625 binding
- 688:691 binding
- 692 E→Q: Loss of activity.
O33819 4-hydroxybenzoyl-CoA reductase subunit alpha; 4-HBCR subunit alpha; EC 1.1.7.1 from Thauera aromatica (see paper)
29% identity, 12% coverage: 601:742/1175 of query aligns to 619:764/769 of O33819
Sites not aligning to the query:
- 214 binding
- 244:245 binding
- 522:526 binding
1rm6A Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
29% identity, 12% coverage: 601:742/1175 of query aligns to 611:756/761 of 1rm6A
- active site: E718 (≠ S707), G719 (≠ V708)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): L646 (≠ I636), N647 (= N637), V651 (= V641), Q654 (= Q644), K714 (≠ G703), E715 (= E704), A716 (≠ S705), S717 (≠ A706), E718 (≠ S707)
Sites not aligning to the query:
- active site: 206, 241, 318, 322, 350
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 235, 236, 237, 238, 350, 473, 474, 475, 476, 513, 514, 515, 517, 518
1dgjA Crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 (see paper)
33% identity, 13% coverage: 584:740/1175 of query aligns to 757:905/906 of 1dgjA
- active site: E869 (= E704), M870 (≠ S705)
- binding molybdenum (iv)oxide: E869 (= E704)
- binding pterin cytosine dinucleotide: C799 (≠ I636), N800 (= N637), V803 (≠ G640), V804 (= V641), Q807 (= Q644), S865 (≠ M700), G866 (= G701), V867 (≠ A702), G868 (= G703), E869 (= E704)
Sites not aligning to the query:
- active site: 391, 427, 503, 507, 535
- binding molybdenum (iv)oxide: 424, 535, 698
- binding fe2/s2 (inorganic) cluster: 38, 39, 40, 41, 43, 44, 45, 46, 48, 58, 60, 100, 101, 103, 137, 139
- binding pterin cytosine dinucleotide: 99, 139, 423, 424, 535, 652, 655, 656, 657, 658, 697, 698, 700, 702, 703
5y6qC Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
24% identity, 29% coverage: 265:599/1175 of query aligns to 110:439/748 of 5y6qC
Sites not aligning to the query:
- active site: 715, 716
- binding pterin cytosine dinucleotide: 461, 462, 463, 464, 468, 500, 502, 503, 504, 505, 638, 640, 641, 648, 711, 713, 714, 715
4usaA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with trans-cinnamaldehyde (see paper)
32% identity, 17% coverage: 548:742/1175 of query aligns to 727:907/907 of 4usaA
- active site: E869 (= E704), L870 (≠ S705)
- binding magnesium ion: E899 (= E734), E903 (≠ A738)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): C799 (≠ I636), N800 (= N637), T804 (≠ V641), Q807 (= Q644), S865 (≠ M700), G866 (= G701), V867 (≠ A702), G868 (= G703), E869 (= E704)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533
- binding bicarbonate ion: 460, 531, 532, 535, 539
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103, 137, 139
- binding hydrocinnamic acid: 255, 425, 494, 497, 535, 626
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 139, 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701
4us9A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with 3- phenylpropionaldehyde (see paper)
32% identity, 17% coverage: 548:742/1175 of query aligns to 727:907/907 of 4us9A
- active site: E869 (= E704), L870 (≠ S705)
- binding 3-phenylpropanal: H752 (≠ M574)
- binding bicarbonate ion: R890 (= R725), Y892 (≠ R727)
- binding magnesium ion: E899 (= E734), E903 (≠ A738)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): C799 (≠ I636), N800 (= N637), T804 (≠ V641), Q807 (= Q644), S865 (≠ M700), G866 (= G701), V867 (≠ A702), G868 (= G703), E869 (= E704)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533
- binding 3-phenylpropanal: 255, 257, 258
- binding bicarbonate ion: 460, 498, 531, 532, 535, 539
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103, 137, 139
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 139, 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701
4us8A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with benzaldehyde (see paper)
32% identity, 17% coverage: 548:742/1175 of query aligns to 727:907/907 of 4us8A
- active site: E869 (= E704), L870 (≠ S705)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): C799 (≠ I636), N800 (= N637), T804 (≠ V641), Q807 (= Q644), S865 (≠ M700), G866 (= G701), V867 (≠ A702), G868 (= G703), E869 (= E704)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533
- binding bicarbonate ion: 460, 498, 531, 532, 535, 539
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103, 137, 139
- binding benzaldehyde: 255, 255, 394, 425, 425, 425, 425, 497, 497, 501, 531, 535, 535, 626, 626, 626, 694, 696, 697
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 139, 420, 421, 422, 533, 653, 654, 655, 656, 695, 696, 697, 700, 701
Query Sequence
>GFF2557 FitnessBrowser__WCS417:GFF2557
MTDTSLSRDQWLAKTGVLLIIDDVLPPSGPVAKGGTPTVKPKELGLFIAVNDDGLVYAFN
GHVDLGTGIRTSLAQIVAEELDLTMEQVKMVLGDTERVPNQGATIASATLQISAVPLRNA
AAEARRFLLARAAGRLGVSTASLKVDAGVIHAADGRTTTYAELVSGQHDQLRISGDAPLK
PIEDYRLVGKGAARVDIPGKATGELTYVHDMRVPGMLHGRVIRPPYAGLDCGDFVGNSLL
SVDESSIAHIPGIVAVVVIRDFVGVVALREEQAVKAASELQVHWKPWNHGLPDMTDVEQA
IRDNPRVRRTVLDQGNVDEALAGASQRMPRSYLWPYQMHGSIGPSCGVADYSPAGSRVWS
GSQNPHLLRADLAWLLACDEALIDVIRMEAAGCYGRNCADDVCADALLLSRAVGKPVRVQ
LTREQEHLWEPKGTAQLMDVDGGLNADGSIAAYDFETSYPSNGAPTLALLLTGRVEPVAA
MFEMGDRTSIPPYDIDTMRVTINDMAPIVRASWMRGVSALPNTFAHESYIDELAFAAGVD
PVEYRLRYLKDERAIDLVKSTAERANWTPRTAPMQTASDDHLLRGRGFAYARYIHSKFPG
FGAAWAAWVADVAIDKQTGDVSVTRVVIGHDSGMMINPDGVQHQIHGNVIQSTSRVLKER
VTFEESTVASKEWGGYPILTFPEVPKIDVMMMPRQDQPPMGAGESASVPSAAAIANAIYD
ATGIRFRELPITPERVLAALNAGTLGEPAKSPEKRRKWWFGALFATLGAVLATAWPFHAE
IPPIAPPSAGTWSKATLERGRLLAAVGDCAVCHTAPGGATNAGGLAMQTPFGTLYSSNIT
PDVKTGIGAWSYPAFERAMRDGIGRDGRNLYPAFPYTAFRNINEADMQALYAYLMSQVPV
SQAPTPNAMRFPFNIRPLMAGWNALNLRRGEISPQPERSEQWNRGNYLVNGLGHCAACHS
PRNLMGAEKGGKSFLAGGTVDGWEAPALNGLSKASTPWTEDQLFTYLSTGYSDAHGVAAG
PMGPVVSELSKLPKADIRAMAVYLASLKGDAAAEAPAVTAANVPNPDGRRVFEGACKACH
ADGLGPKLFGVSPSFATNTNVHSDQPDNLIKVILQGISKPATQDLGYMPGFKDSLSNSQV
ADLAAYLRAQFAPNAPQWKGLEQKVAHLRANPGTH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory