Comparing GFF2578 FitnessBrowser__WCS417:GFF2578 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
7cdyA Crystal structure of glucose dehydrogenase
66% identity, 89% coverage: 38:381/385 of query aligns to 2:344/346 of 7cdyA
2g8sA Crystal structure of the soluble aldose sugar dehydrogenase (asd) from escherichia coli in the apo-form (see paper)
62% identity, 90% coverage: 36:380/385 of query aligns to 2:345/348 of 2g8sA
P75804 Aldose sugar dehydrogenase YliI; Asd; Soluble aldose sugar dehydrogenase YliI; EC 1.1.5.- from Escherichia coli (strain K12) (see paper)
60% identity, 95% coverage: 16:380/385 of query aligns to 8:367/371 of P75804
7cgzA Glucose dehydrogenase
60% identity, 89% coverage: 38:381/385 of query aligns to 2:319/321 of 7cgzA
2ismB Crystal structure of the putative oxidoreductase (glucose dehydrogenase) (ttha0570) from thermus theromophilus hb8
38% identity, 87% coverage: 42:375/385 of query aligns to 7:318/333 of 2ismB
3a9hA Crystal structure of pqq-dependent sugar dehydrogenase holo-form (see paper)
36% identity, 87% coverage: 40:375/385 of query aligns to 7:319/338 of 3a9hA
Sites not aligning to the query:
3a9gA Crystal structure of pqq-dependent sugar dehydrogenase apo-form (see paper)
36% identity, 87% coverage: 40:375/385 of query aligns to 7:319/338 of 3a9gA
P13650 Quinoprotein glucose dehydrogenase B; Glucose dehydrogenase B [pyrroloquinoline-quinone]; Soluble glucose dehydrogenase; s-GDH; EC 1.1.5.2 from Acinetobacter calcoaceticus (see paper)
27% identity, 98% coverage: 1:376/385 of query aligns to 5:453/478 of P13650
1cruA Soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqq and methylhydrazine (see paper)
27% identity, 94% coverage: 17:376/385 of query aligns to 2:427/448 of 1cruA
3dasA Structure of the pqq-bound form of aldose sugar dehydrogenase (adh) from streptomyces coelicolor
30% identity, 90% coverage: 31:375/385 of query aligns to 2:317/334 of 3dasA
Sites not aligning to the query:
1cq1A Soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqqh2 and glucose (see paper)
27% identity, 94% coverage: 17:376/385 of query aligns to 2:423/444 of 1cq1A
1c9uA Crystal structure of the soluble quinoprotein glucose dehydrogenase in complex with pqq (see paper)
27% identity, 94% coverage: 17:376/385 of query aligns to 2:423/444 of 1c9uA
5minB Apo form of the soluble pqq-dependent glucose dehydrogenase from acinetobacter calcoaceticus
27% identity, 94% coverage: 17:376/385 of query aligns to 2:429/453 of 5minB
2wfxB Crystal structure of the complex between human hedgehog-interacting protein hip and sonic hedgehog in the presence of calcium (see paper)
23% identity, 58% coverage: 42:263/385 of query aligns to 8:246/417 of 2wfxB
Sites not aligning to the query:
>GFF2578 FitnessBrowser__WCS417:GFF2578
MFLRKSLLAALCATTLLPLTAAYAADAQQFPSEQGSISATPIAKGLDHPWAVAFLPDKQG
FLVTERPGHLRFVSPDGKLSAPLKGVPEVWAKGQGGLLDVVLSPDFKEDRTVYLSYAEGG
GKDGTAGTAVGRGRLAADLSGLTDFKVILRQEPKLSTGNHFGSRLAFDRDGYLFVTLGEN
NDRPTAQDLDKLQGKVVRIYPDGRVPDDNPFVGQQGVRPEIWSYGQRNPQGLALNPWSGT
IWENEHGPRGGDEINIIERGKNYGWPLATHGINYSLTPIPEAKGKTVEGTVPPHHVWEKS
PGISGMAFYDADRFKPWQHNVFIGALATQELIRLQFDGDKVIHEERLLGGLKARIRDVRQ
GPDGFLYVLTDEEDGVLYRVGLNQD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory