SitesBLAST
Comparing GFF2597 FitnessBrowser__Marino:GFF2597 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
31% identity, 96% coverage: 8:268/273 of query aligns to 4:256/259 of 5zaiC
- active site: A65 (≠ G69), F70 (≠ M74), S82 (≠ Y91), R86 (= R95), G110 (= G122), E113 (≠ G125), P132 (= P144), E133 (= E145), I138 (≠ V150), P140 (= P152), G141 (≠ A153), A226 (vs. gap), F236 (≠ I248)
- binding coenzyme a: K24 (≠ V28), L25 (≠ R29), A63 (= A67), G64 (= G68), A65 (≠ G69), D66 (= D70), I67 (= I71), P132 (= P144), R166 (= R177), F248 (= F260), K251 (= K263)
5jbxB Crystal structure of liuc in complex with coenzyme a and malonic acid (see paper)
33% identity, 97% coverage: 5:268/273 of query aligns to 2:258/261 of 5jbxB
- active site: A67 (≠ G69), R72 (≠ M74), L84 (≠ Y91), R88 (≠ N94), G112 (= G122), E115 (≠ G125), T134 (≠ P144), E135 (= E145), I140 (≠ V150), P142 (= P152), G143 (≠ A153), A228 (≠ D238), L238 (≠ I248)
- binding coenzyme a: S24 (≠ D27), R25 (≠ V28), R26 (= R29), A28 (= A31), A65 (= A67), D68 (= D70), L69 (≠ I71), K70 (= K72), L110 (≠ M120), G111 (= G121), T134 (≠ P144), E135 (= E145), L138 (= L148), R168 (= R177)
3h81A Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis (see paper)
32% identity, 96% coverage: 8:268/273 of query aligns to 3:253/256 of 3h81A
- active site: A64 (≠ G69), M69 (= M74), T79 (≠ N94), F83 (≠ G98), G107 (= G122), E110 (≠ G125), P129 (= P144), E130 (= E145), V135 (= V150), P137 (= P152), G138 (≠ A153), L223 (≠ D238), F233 (≠ I248)
- binding calcium ion: F233 (≠ I248), Q238 (≠ G253)
6slbAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
30% identity, 95% coverage: 10:268/273 of query aligns to 5:254/257 of 6slbAAA
- active site: Q64 (≠ G69), F69 (≠ M74), L80 (vs. gap), N84 (≠ G98), A108 (≠ G122), S111 (≠ G125), A130 (≠ P144), F131 (≠ E145), L136 (≠ V150), P138 (= P152), D139 (≠ A153), A224 (≠ D238), G234 (≠ I248)
- binding (~{E})-6-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-6-oxidanylidene-hex-3-enoic acid: R58 (≠ G63), A62 (= A67), Q64 (≠ G69), D65 (= D70), L66 (≠ I71), Y76 (= Y91), A108 (≠ G122), F131 (≠ E145), D139 (≠ A153)
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
32% identity, 96% coverage: 8:268/273 of query aligns to 4:254/255 of 3q0jC
- active site: A65 (≠ G69), M70 (= M74), T80 (≠ N94), F84 (≠ G98), G108 (= G122), E111 (≠ G125), P130 (= P144), E131 (= E145), V136 (= V150), P138 (= P152), G139 (≠ A153), L224 (≠ D238), F234 (≠ I248)
- binding acetoacetyl-coenzyme a: Q23 (≠ D27), A24 (≠ V28), L25 (≠ R29), A27 (= A31), A63 (= A67), G64 (= G68), A65 (≠ G69), D66 (= D70), I67 (= I71), K68 (= K72), M70 (= M74), F84 (≠ G98), G107 (= G121), G108 (= G122), E111 (≠ G125), P130 (= P144), E131 (= E145), P138 (= P152), G139 (≠ A153), M140 (≠ Q154)
3q0gC Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
32% identity, 96% coverage: 8:268/273 of query aligns to 4:254/255 of 3q0gC
- active site: A65 (≠ G69), M70 (= M74), T80 (≠ N94), F84 (≠ G98), G108 (= G122), E111 (≠ G125), P130 (= P144), E131 (= E145), V136 (= V150), P138 (= P152), G139 (≠ A153), L224 (≠ D238), F234 (≠ I248)
- binding coenzyme a: L25 (≠ R29), A63 (= A67), I67 (= I71), K68 (= K72), Y104 (≠ A118), P130 (= P144), E131 (= E145), L134 (= L148)
3q0gD Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
32% identity, 96% coverage: 8:268/273 of query aligns to 3:249/250 of 3q0gD
- active site: A64 (≠ G69), M69 (= M74), T75 (≠ N94), F79 (≠ G98), G103 (= G122), E106 (≠ G125), P125 (= P144), E126 (= E145), V131 (= V150), P133 (= P152), G134 (≠ A153), L219 (≠ D238), F229 (≠ I248)
- binding Butyryl Coenzyme A: F225 (= F244), F241 (= F260)
O53561 Enoyl-CoA hydratase EchA19; EC 4.2.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
30% identity, 94% coverage: 11:266/273 of query aligns to 11:261/266 of O53561
- K135 (= K140) modified: N6-succinyllysine; mutation to E: Nearly wild-type levels of succinylation in vitro, reduces specific activity 8-fold.
- 135:142 (vs. 140:147, 50% identical) mutation to EFGISEAE: Very low levels of succinylation in vitro, reduces specific activity 15-fold.
- K142 (≠ S147) modified: N6-succinyllysine; mutation to E: About 50% succinylation in vitro, reduces specific activity 7-fold.
6slaAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
28% identity, 95% coverage: 10:268/273 of query aligns to 2:242/245 of 6slaAAA
- active site: Q61 (≠ G69), L68 (≠ N94), N72 (≠ G98), A96 (≠ G122), S99 (≠ G125), A118 (≠ P144), F119 (≠ E145), L124 (≠ V150), P126 (= P152), N127 (≠ A153), A212 (≠ D238), G222 (≠ I248)
- binding ~{S}-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethyl] 2-(2,5-dihydrooxepin-7-yl)ethanethioate: L21 (≠ R29), A59 (= A67), Q61 (≠ G69), D62 (= D70), L63 (≠ I71), L68 (≠ N94), Y71 (≠ F97), A94 (≠ M120), G95 (= G121), A96 (≠ G122), F119 (≠ E145), I122 (≠ L148), L124 (≠ V150), N127 (≠ A153), F234 (= F260), K237 (= K263)
Q4WF54 Mevalonyl-coenzyme A hydratase sidH; Siderophore biosynthesis protein H; EC 4.2.1.- from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) (Neosartorya fumigata) (see paper)
31% identity, 93% coverage: 19:272/273 of query aligns to 22:269/270 of Q4WF54
Sites not aligning to the query:
- 268:270 PTS1-type peroxisomal targeting signal
3bptA Crystal structure of human beta-hydroxyisobutyryl-coa hydrolase in complex with quercetin
34% identity, 69% coverage: 8:196/273 of query aligns to 5:189/362 of 3bptA
- active site: G67 (= G69), P84 (≠ D88), R88 (= R92), G115 (= G122), G118 (= G125), E138 (= E145), D146 (≠ A153)
- binding (2r)-3-hydroxy-2-methylpropanoic acid: G66 (= G68), G67 (= G69), I69 (= I71), E90 (vs. gap), G114 (= G121), G115 (= G122), E138 (= E145), D146 (≠ A153), V147 (≠ Q154)
- binding 3,5,7,3',4'-pentahydroxyflavone: F25 (≠ V28), L26 (≠ R29), A28 (= A31), G66 (= G68), G67 (= G69), I69 (= I71), P137 (= P144), I141 (≠ L148)
Sites not aligning to the query:
Q8GYN9 1,4-dihydroxy-2-naphthoyl-CoA synthase, peroxisomal; DHNS; Enoyl-CoA hydratase/isomerase D; ECHID; Naphthoate synthase; EC 4.1.3.36 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 92% coverage: 21:270/273 of query aligns to 90:332/337 of Q8GYN9
Sites not aligning to the query:
- 20 H→V: Loss of peroxisomal targeting.
4i52A Scmenb im complex with 1-hydroxy-2-naphthoyl-coa (see paper)
31% identity, 97% coverage: 6:270/273 of query aligns to 8:270/275 of 4i52A
- active site: G77 (= G69), R82 (≠ A75), Y87 (≠ Q80), R95 (= R92), L99 (≠ A96), G123 (= G122), V126 (≠ G125), G146 (≠ E145), S151 (≠ V150), D153 (≠ P152), G154 (≠ A153), A240 (= A240), Y248 (≠ I248)
- binding 1-hydroxy-2-naphthoyl-CoA: H29 (≠ D27), K30 (≠ V28), R31 (= R29), A33 (= A31), S75 (≠ A67), G76 (= G68), G77 (= G69), D78 (= D70), Q79 (≠ K72), L96 (= L93), V98 (≠ R95), Y119 (≠ A118), I121 (≠ M120), G123 (= G122), T145 (≠ P144), V149 (≠ L148), S151 (≠ V150), F152 (≠ I151)
4i4zA Synechocystis sp. Pcc 6803 1,4-dihydroxy-2-naphthoyl-coenzyme a synthase (menb) in complex with salicylyl-coa (see paper)
31% identity, 97% coverage: 6:270/273 of query aligns to 8:270/275 of 4i4zA
- active site: G77 (= G69), R82 (≠ A75), Y87 (≠ Q80), R95 (= R92), L99 (≠ A96), G123 (= G122), V126 (≠ G125), G146 (≠ E145), S151 (≠ V150), D153 (≠ P152), G154 (≠ A153), A240 (= A240), Y248 (≠ I248)
- binding Salicylyl CoA: H29 (≠ D27), K30 (≠ V28), R31 (= R29), S75 (≠ A67), G76 (= G68), G77 (= G69), D78 (= D70), Q79 (≠ K72), Y87 (≠ Q80), V98 (≠ R95), G123 (= G122), T145 (≠ P144), V149 (≠ L148), S151 (≠ V150), F260 (= F260), K263 (= K263)
- binding bicarbonate ion: G122 (= G121), Q144 (≠ M143), T145 (≠ P144), G146 (≠ E145), W174 (≠ A172)
Q5HH38 1,4-dihydroxy-2-naphthoyl-CoA synthase; DHNA-CoA synthase; EC 4.1.3.36 from Staphylococcus aureus (strain COL) (see paper)
31% identity, 90% coverage: 21:266/273 of query aligns to 26:264/273 of Q5HH38
- R34 (= R29) binding in other chain
- SGGDQ 73:77 (≠ AGGDI 67:71) binding in other chain
- S149 (≠ V150) binding in other chain
Q9LKJ1 3-hydroxyisobutyryl-CoA hydrolase 1; CoA-thioester hydrolase CHY1; EC 3.1.2.-; EC 3.1.2.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 66% coverage: 10:188/273 of query aligns to 11:185/378 of Q9LKJ1
- G70 (= G69) mutation to S: Loss of activity.
- E142 (= E145) mutation to A: Loss of activity.
- D150 (≠ A153) mutation to G: Reduced activity.
4emlA Synechocystis sp. Pcc 6803 1,4-dihydroxy-2-naphthoyl-coenzyme a synthase (menb) in complex with bicarbonate (see paper)
30% identity, 97% coverage: 6:270/273 of query aligns to 8:256/261 of 4emlA
- active site: G77 (= G69), R81 (= R92), L85 (≠ A96), G109 (= G122), V112 (≠ G125), G132 (≠ E145), S137 (≠ V150), D139 (≠ P152), G140 (≠ A153), A226 (= A240), Y234 (≠ I248)
- binding bicarbonate ion: G108 (= G121), Q130 (≠ M143), G132 (≠ E145), W160 (≠ A172)
- binding chloride ion: D184 (= D197), R185 (≠ E198), E187 (= E200), E188 (= E201)
2uzfA Crystal structure of staphylococcus aureus 1,4-dihydroxy-2-naphthoyl coa synthase (menb) in complex with acetoacetyl coa (see paper)
31% identity, 90% coverage: 21:266/273 of query aligns to 21:251/260 of 2uzfA
- active site: G70 (= G69), R80 (= R92), L84 (≠ A96), G108 (= G122), V111 (≠ G125), T130 (≠ P144), G131 (≠ E145), S136 (≠ V150), D138 (≠ P152), A139 (= A153), A225 (= A240), Y233 (≠ I248)
- binding acetoacetyl-coenzyme a: V28 (= V28), R29 (= R29), S68 (≠ A67), G69 (= G68), G70 (= G69), D71 (= D70), Y104 (≠ A118), G108 (= G122)
P14604 Enoyl-CoA hydratase, mitochondrial; mECH; mECH1; Enoyl-CoA hydratase 1; ECHS1; Short-chain enoyl-CoA hydratase; SCEH; EC 4.2.1.17; EC 5.3.3.8 from Rattus norvegicus (Rat) (see 3 papers)
27% identity, 96% coverage: 8:270/273 of query aligns to 34:289/290 of P14604
- E144 (≠ G125) mutation to D: Reduces activity 50-fold.; mutation to Q: Reduces activity 3300-fold.
- E164 (= E145) mutation to D: Reduces activity 1250-fold.; mutation to Q: Reduces activity 330000-fold.
Sites not aligning to the query:
- 1:29 modified: transit peptide, Mitochondrion
4i42A E.Coli. 1,4-dihydroxy-2-naphthoyl coenzyme a synthase (ecmenb) in complex with 1-hydroxy-2-naphthoyl-coa (see paper)
29% identity, 92% coverage: 21:270/273 of query aligns to 37:280/285 of 4i42A
- active site: G86 (= G69), R91 (= R78), Y97 (≠ E84), H105 (≠ R92), L109 (≠ A96), G133 (= G122), V136 (≠ G125), G156 (≠ E145), S161 (≠ V150), D163 (≠ P152), G164 (≠ A153), A250 (= A240), Y258 (≠ I248)
- binding 1-hydroxy-2-naphthoyl-CoA: V44 (= V28), R45 (= R29), S84 (≠ A67), G85 (= G68), G86 (= G69), D87 (= D70), Q88 (≠ I71), K89 (= K72), Y97 (≠ E84), V108 (≠ R95), Y129 (≠ A118), G133 (= G122), T155 (≠ P144), S161 (≠ V150), T254 (≠ F244), F270 (= F260), K273 (= K263)
Query Sequence
>GFF2597 FitnessBrowser__Marino:GFF2597
MDQVPHCETLLLEKQGPTLFITINRPDVRNAMSLEMVAELSAVFTQIENDLHIRAVVIRG
AGGHFCAGGDIKDMAGARGQKAAEGEADPFYRLNRAFGQMIQQVNESSKVVIAITEGAVM
GGGFGLACVSDVAIAGPSAKFGMPETSLGVIPAQIAPFVVERIGLTQARRLALLGLRIDA
NEACSLGIVHQAASSDDELEEMLTSALDRVRHCAPVATAETKALLHRVGHEPISGLLDSA
AEKFAEAIRGSEGTEGTMAFMQKRPPAWAESND
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory