SitesBLAST
Comparing GFF2598 HP15_2542 methylcrotonoyl-coenzyme A carboxylase 1 (alpha) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P9WPQ3 Biotin-dependent 3-methylcrotonyl-coenzyme A carboxylase alpha1 subunit; EC 6.3.4.14 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
47% identity, 98% coverage: 1:644/656 of query aligns to 1:652/654 of P9WPQ3
- K322 (≠ P320) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
7ybuA Human propionyl-coenzyme a carboxylase
42% identity, 98% coverage: 4:644/656 of query aligns to 7:669/670 of 7ybuA
P05165 Propionyl-CoA carboxylase alpha chain, mitochondrial; PCCase subunit alpha; Propanoyl-CoA:carbon dioxide ligase subunit alpha; EC 6.4.1.3 from Homo sapiens (Human) (see 6 papers)
42% identity, 98% coverage: 4:644/656 of query aligns to 65:727/728 of P05165
- A75 (= A14) to P: in PA-1; dbSNP:rs794727479
- R77 (= R16) to W: in PA-1; loss of function; dbSNP:rs141371306
- A138 (≠ C77) to T: in PA-1; loss of function; dbSNP:rs202247814
- I164 (≠ V103) to T: in PA-1; loss of function; dbSNP:rs202247815
- G197 (= G136) to E: in PA-1
- M229 (= M168) to K: in PA-1; dbSNP:rs375628794
- Q297 (= Q236) to R: in PA-1
- D368 (= D307) to G: in PA-1
- M373 (≠ Q312) to K: in PA-1; unstable protein; loss of function; dbSNP:rs121964958
- G379 (= G318) to V: in PA-1; dbSNP:rs794727087
- C398 (≠ V337) to R: in PA-1
- R399 (= R338) to Q: in PA-1; dbSNP:rs1301904623
- P423 (= P360) to L: in PA-1; dbSNP:rs1443858896
- L532 (≠ V467) natural variant: Missing (in PA-1)
- V551 (≠ M485) to F: in dbSNP:rs61749895
- W559 (≠ G493) to L: in PA-1; dbSNP:rs118169528
- G631 (= G555) to R: in PA-1; loss of function; dbSNP:rs796052018
- G668 (= G585) to R: in PA-1; loss of biotinylation; dbSNP:rs771438170
- K694 (= K611) modified: N6-biotinyllysine; by HLCS
- C712 (≠ A629) natural variant: Missing (in PA-1; loss of biotinylation)
Sites not aligning to the query:
- 1:52 modified: transit peptide, Mitochondrion
Q5LUF3 Propionyl-CoA carboxylase alpha chain; EC 6.4.1.3 from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) (Silicibacter pomeroyi) (see paper)
41% identity, 98% coverage: 1:644/656 of query aligns to 1:680/681 of Q5LUF3
- F348 (= F348) binding
- W515 (= W478) mutation to L: No effect on holoenzyme formation.
- L599 (≠ T570) mutation to A: Loss of holoenzyme formation; when associated with A-602 and A-603.
- L602 (vs. gap) mutation to A: Loss of holoenzyme formation; when associated with A-602 and A-603.
- M603 (vs. gap) mutation to A: No effect on holoenzyme formation. Loss of holoenzyme formation; when associated with A-602 and A-603.
- K647 (= K611) modified: N6-biotinyllysine
3n6rG Crystal structure of the holoenzyme of propionyl-coa carboxylase (pcc) (see paper)
42% identity, 98% coverage: 2:644/656 of query aligns to 1:645/646 of 3n6rG
- active site: K115 (= K116), K157 (= K158), D180 (= D195), H193 (= H208), R219 (= R234), T258 (= T273), E260 (= E275), E273 (= E288), N275 (= N290), R277 (= R292), E281 (= E296), R323 (= R338), G519 (≠ R525)
- binding 5-(hexahydro-2-oxo-1h-thieno[3,4-d]imidazol-6-yl)pentanal: M611 (= M610), K612 (= K611)
2vr1A Crystal structure of biotin carboxylase from e. Coli in complex with atp analog, adpcf2p. (see paper)
52% identity, 68% coverage: 1:445/656 of query aligns to 1:442/444 of 2vr1A
- active site: K116 (= K116), K159 (= K158), D194 (= D195), H207 (= H208), R233 (= R234), T272 (= T273), E274 (= E275), E286 (= E288), N288 (= N290), R290 (= R292), E294 (= E296), R336 (= R338)
- binding phosphodifluoromethylphosphonic acid-adenylate ester: K159 (= K158), R165 (= R166), M167 (= M168), Y201 (≠ A202), L202 (≠ V203), E274 (= E275), L276 (= L277), E286 (= E288), N288 (= N290), I435 (≠ T438)
8sgxX Leishmania tarentolae propionyl-coa carboxylase (alpha-4-beta-6) (see paper)
40% identity, 98% coverage: 5:644/656 of query aligns to 1:656/657 of 8sgxX
4mv4A Crystal structure of biotin carboxylase from haemophilus influenzae in complex with amppcp and mg2 (see paper)
52% identity, 68% coverage: 1:445/656 of query aligns to 1:441/442 of 4mv4A
- active site: K116 (= K116), K159 (= K158), D193 (= D195), H206 (= H208), R232 (= R234), T271 (= T273), E273 (= E275), E285 (= E288), N287 (= N290), R289 (= R292), E293 (= E296), R335 (= R338)
- binding phosphomethylphosphonic acid adenylate ester: K159 (= K158), G164 (= G163), M166 (= M168), E198 (= E200), Y200 (≠ A202), L201 (≠ V203), H233 (= H235), L275 (= L277), E285 (= E288)
- binding magnesium ion: E273 (= E275), E285 (= E288)
3rupA Crystal structure of e.Coli biotin carboxylase in complex with two adp and two ca ions (see paper)
52% identity, 68% coverage: 1:445/656 of query aligns to 1:444/444 of 3rupA
- active site: K116 (= K116), K159 (= K158), D196 (= D195), H209 (= H208), R235 (= R234), T274 (= T273), E276 (= E275), E288 (= E288), N290 (= N290), R292 (= R292), E296 (= E296), R338 (= R338)
- binding adenosine-5'-diphosphate: Y82 (= Y82), G83 (= G83), K116 (= K116), K159 (= K158), G164 (= G163), G164 (= G163), G165 (= G164), G166 (= G165), R167 (= R166), M169 (= M168), F193 (= F192), E201 (= E200), K202 (= K201), Y203 (≠ A202), L204 (≠ V203), H209 (= H208), Q233 (= Q232), H236 (= H235), K238 (= K237), L278 (= L277), E288 (= E288), R292 (= R292), V295 (= V295), E296 (= E296), R338 (= R338), D382 (= D383), I437 (≠ T438)
- binding calcium ion: E87 (= E87), E276 (= E275), E288 (= E288), E288 (= E288), N290 (= N290)
3g8cA Crystal structure of biotin carboxylase in complex with biotin, bicarbonate, adp and mg ion (see paper)
52% identity, 68% coverage: 1:445/656 of query aligns to 1:444/444 of 3g8cA
- active site: K116 (= K116), K159 (= K158), D196 (= D195), H209 (= H208), R235 (= R234), T274 (= T273), E276 (= E275), E288 (= E288), N290 (= N290), R292 (= R292), E296 (= E296), R338 (= R338)
- binding adenosine-5'-diphosphate: I157 (≠ M156), K159 (= K158), G164 (= G163), M169 (= M168), E201 (= E200), K202 (= K201), Y203 (≠ A202), L204 (≠ V203), Q233 (= Q232), H236 (= H235), L278 (= L277), E288 (= E288), I437 (≠ T438)
- binding bicarbonate ion: K238 (= K237), R292 (= R292), Q294 (= Q294), V295 (= V295), E296 (= E296)
- binding biotin: Y82 (= Y82), F84 (= F84), R292 (= R292), V295 (= V295), R338 (= R338), D382 (= D383)
- binding magnesium ion: E276 (= E275), E288 (= E288)
3jziA Crystal structure of biotin carboxylase from e. Coli in complex with benzimidazole series (see paper)
52% identity, 68% coverage: 1:445/656 of query aligns to 1:444/445 of 3jziA
- active site: K116 (= K116), K159 (= K158), D196 (= D195), H209 (= H208), R235 (= R234), T274 (= T273), E276 (= E275), E288 (= E288), N290 (= N290), R292 (= R292), E296 (= E296), R338 (= R338)
- binding 7-amino-2-[(2-chlorobenzyl)amino]-1-{[(1S,2S)-2-hydroxycycloheptyl]methyl}-1H-benzimidazole-5-carboxamide: K116 (= K116), K159 (= K158), A160 (= A159), G164 (= G163), G165 (= G164), M169 (= M168), Y199 (≠ I198), E201 (= E200), K202 (= K201), Y203 (≠ A202), H209 (= H208), Q233 (= Q232), H236 (= H235), L278 (= L277), I287 (≠ L287), E288 (= E288)
2w6oA Crystal structure of biotin carboxylase from e. Coli in complex with 4-amino-7,7-dimethyl-7,8-dihydro-quinazolinone fragment (see paper)
52% identity, 68% coverage: 1:445/656 of query aligns to 1:444/445 of 2w6oA
- active site: K116 (= K116), K159 (= K158), D196 (= D195), H209 (= H208), R235 (= R234), T274 (= T273), E276 (= E275), E288 (= E288), N290 (= N290), R292 (= R292), E296 (= E296), R338 (= R338)
- binding 4-amino-7,7-dimethyl-7,8-dihydroquinazolin-5(6H)-one: K159 (= K158), K202 (= K201), Y203 (≠ A202), L204 (≠ V203), L278 (= L277), I437 (≠ T438)
2w6nA Crystal structure of biotin carboxylase from e. Coli in complex with amino-oxazole fragment series (see paper)
52% identity, 68% coverage: 1:445/656 of query aligns to 1:444/445 of 2w6nA
- active site: K116 (= K116), K159 (= K158), D196 (= D195), H209 (= H208), R235 (= R234), T274 (= T273), E276 (= E275), E288 (= E288), N290 (= N290), R292 (= R292), E296 (= E296), R338 (= R338)
- binding 2-amino-n,n-bis(phenylmethyl)-1,3-oxazole-5-carboxamide: I157 (≠ M156), K159 (= K158), M169 (= M168), E201 (= E200), K202 (= K201), Y203 (≠ A202), L278 (= L277)
2v59A Crystal structure of biotin carboxylase from e.Coli in complex with potent inhibitor 2 (see paper)
52% identity, 68% coverage: 1:445/656 of query aligns to 1:444/445 of 2v59A
- active site: K116 (= K116), K159 (= K158), D196 (= D195), H209 (= H208), R235 (= R234), T274 (= T273), E276 (= E275), E288 (= E288), N290 (= N290), R292 (= R292), E296 (= E296), R338 (= R338)
- binding 6-(2,6-dimethoxyphenyl)pyrido[2,3-d]pyrimidine-2,7-diamine: K159 (= K158), Y203 (≠ A202), L204 (≠ V203), H209 (= H208), Q233 (= Q232), H236 (= H235), L278 (= L277), I437 (≠ T438)
3jzfB Crystal structure of biotin carboxylase from e. Coli in complex with benzimidazoles series (see paper)
52% identity, 68% coverage: 1:445/656 of query aligns to 3:446/447 of 3jzfB
- active site: K118 (= K116), K161 (= K158), D198 (= D195), H211 (= H208), R237 (= R234), T276 (= T273), E278 (= E275), E290 (= E288), N292 (= N290), R294 (= R292), E298 (= E296), R340 (= R338)
- binding 2-[(2-chlorobenzyl)amino]-1-(cyclohexylmethyl)-1H-benzimidazole-5-carboxamide: K118 (= K116), K161 (= K158), A162 (= A159), G166 (= G163), G168 (= G165), R169 (= R166), G170 (= G167), M171 (= M168), Y201 (≠ I198), E203 (= E200), K204 (= K201), Y205 (≠ A202), H211 (= H208), H238 (= H235), L280 (= L277), I289 (≠ L287), E290 (= E288)
P24182 Biotin carboxylase; Acetyl-coenzyme A carboxylase biotin carboxylase subunit A; EC 6.3.4.14 from Escherichia coli (strain K12) (see 3 papers)
52% identity, 68% coverage: 1:445/656 of query aligns to 1:444/449 of P24182
- R19 (= R19) mutation to E: Loss of homodimerization. No effect on ATP binding.
- E23 (≠ A23) mutation to R: Loss of homodimerization. No effect on ATP binding.
- K116 (= K116) binding
- K159 (= K158) binding
- GG 165:166 (= GG 164:165) binding
- EKYL 201:204 (≠ EKAV 200:203) binding
- H209 (= H208) binding
- H236 (= H235) binding
- K238 (= K237) binding
- E276 (= E275) binding ; binding
- E288 (= E288) binding ; binding
- R292 (= R292) active site; binding
- V295 (= V295) binding
- E296 (= E296) mutation to A: Severe reduction in catalytic activity.
- R338 (= R338) binding ; binding ; mutation to A: Severe reduction in catalytic activity.
- F363 (≠ E364) mutation to A: Loss of homodimerization. No effect on ATP binding.
- R366 (= R367) mutation to E: Loss of homodimerization. No effect on ATP binding.
6oi9A Crystal structure of e. Coli biotin carboxylase complexed with 7-[3- (aminomethyl)pyrrolidin-1-yl]-6-(2,6-dichlorophenyl)pyrido[2,3- d]pyrimidin-2-amine (see paper)
52% identity, 68% coverage: 1:445/656 of query aligns to 1:444/446 of 6oi9A
- active site: E276 (= E275), E288 (= E288), N290 (= N290), E296 (= E296), R338 (= R338)
- binding 7-[(3S)-3-(aminomethyl)pyrrolidin-1-yl]-6-(2,6-dichlorophenyl)pyrido[2,3-d]pyrimidin-2-amine: K159 (= K158), M169 (= M168), E201 (= E200), Y203 (≠ A202), L204 (≠ V203), H209 (= H208), Q233 (= Q232), H236 (= H235), E276 (= E275), L278 (= L277), E288 (= E288), I437 (≠ T438)
2w71A Crystal structure of biotin carboxylase from e. Coli in complex with the imidazole-pyrimidine inhibitor (see paper)
52% identity, 68% coverage: 1:445/656 of query aligns to 1:444/446 of 2w71A
- active site: K116 (= K116), K159 (= K158), D196 (= D195), H209 (= H208), R235 (= R234), T274 (= T273), E276 (= E275), E288 (= E288), N290 (= N290), R292 (= R292), E296 (= E296), R338 (= R338)
- binding 4-[1-(2,6-dichlorobenzyl)-2-methyl-1H-imidazol-4-yl]pyrimidin-2-amine: K159 (= K158), Y203 (≠ A202), L204 (≠ V203), H209 (= H208), Q233 (= Q232), H236 (= H235), L278 (= L277), I437 (≠ T438)
2w70A Crystal structure of biotin carboxylase from e. Coli in complex with the amino-thiazole-pyrimidine fragment (see paper)
52% identity, 68% coverage: 1:445/656 of query aligns to 1:444/446 of 2w70A
- active site: K116 (= K116), K159 (= K158), D196 (= D195), H209 (= H208), R235 (= R234), T274 (= T273), E276 (= E275), E288 (= E288), N290 (= N290), R292 (= R292), E296 (= E296), R338 (= R338)
- binding 4-(2-amino-1,3-thiazol-4-yl)pyrimidin-2-amine: I157 (≠ M156), K159 (= K158), G166 (= G165), M169 (= M168), E201 (= E200), Y203 (≠ A202), L204 (≠ V203), L278 (= L277)
2w6zA Crystal structure of biotin carboxylase from e. Coli in complex with the 3-(3-methyl-but-2-enyl)-3h-purin-6-ylamine fragment (see paper)
52% identity, 68% coverage: 1:445/656 of query aligns to 1:444/446 of 2w6zA
- active site: K116 (= K116), K159 (= K158), D196 (= D195), H209 (= H208), R235 (= R234), T274 (= T273), E276 (= E275), E288 (= E288), N290 (= N290), R292 (= R292), E296 (= E296), R338 (= R338)
- binding 3-(3-methylbut-2-en-1-yl)-3H-purin-6-amine: K159 (= K158), Y203 (≠ A202), L204 (≠ V203), L278 (= L277)
Query Sequence
>GFF2598 HP15_2542 methylcrotonoyl-coenzyme A carboxylase 1 (alpha)
MLRKLLIANRGEIAVRVIRTAKALGYRTVAVYSEADAKAMHVELADEAVCIGPAQVSASY
LNSDAILEAARKTGADCIHPGYGFLSENAAFANACKDAGLVFVGPPASAIELMGSKRRSK
IAMQEAGVPVVPGYEGNNANDDELIAAAKDIGYPLMIKASAGGGGRGMRLVESESELADN
IKRARSESKQAFGDDELILEKAVIEPRHVEIQVFADRHGNAVYLGERDCSVQRRHQKVVE
EAPSPFVTPELRQAMGEAAVKAALACNYEGAGTVEFLVDKHRNFYFLEMNTRLQVEHPVT
ELITGQDLVAWQLNVAEGRPLPLSQDDIHLNGHAIEVRLYAEDPAHGFTPQTGSLYAFEP
AEGEGLRFDTGVRSGDAITPHYDPMLAKVIAWGQNRDEARRRLIRSLEDTTVFGVTTNRH
FLSRIIADETFGAGGATTAFLQQAFKDDPSLQPQNLTIRQLALAACVLDHGISGQSAWSN
APATMTPIKLETGDTTVELLVTRSGSRLSVSMGETRHSLVLESQRDGHLCIIDNGVRQAC
QYHRQGDSLYLQAFGQSWSVRDVTHQPARTAGGAGSGRIQATMDGAIIDVLVEAGQSVHQ
GDTLVILEAMKMEHPVKADRDGRVAEILASKGDQVKRSQLLVQITANETAEQENEA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory