SitesBLAST
Comparing GFF2609 FitnessBrowser__Marino:GFF2609 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
39% identity, 92% coverage: 36:477/479 of query aligns to 20:464/465 of 3pm9A
- active site: A149 (= A165), L159 (≠ M175)
- binding flavin-adenine dinucleotide: P69 (= P85), Q70 (≠ S86), G71 (= G87), G72 (= G88), N73 (≠ R89), T74 (= T90), G75 (= G91), L76 (= L92), G79 (= G95), Q80 (≠ A96), L91 (≠ F107), L133 (≠ F149), G134 (≠ A150), A135 (≠ S151), C139 (≠ S155), T140 (≠ Q156), G142 (= G158), G143 (= G159), S146 (= S162), T147 (= T163), A149 (= A165), G150 (= G166), E200 (= E216), G201 (= G217), I205 (≠ F221), I206 (= I222), E423 (= E436)
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
33% identity, 97% coverage: 15:478/479 of query aligns to 11:465/467 of 6lpnB
- binding flavin-adenine dinucleotide: W40 (= W49), P76 (= P85), G78 (= G87), G79 (= G88), N80 (≠ R89), T81 (= T90), G82 (= G91), M83 (≠ L92), G86 (= G95), S87 (≠ A96), L140 (≠ F149), A142 (≠ S151), C146 (≠ S155), H147 (≠ Q156), G150 (= G159), N151 (= N160), A153 (≠ S162), T154 (= T163), G208 (= G217), I212 (≠ F221), I213 (= I222), E423 (= E436), N460 (= N473)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
33% identity, 97% coverage: 15:478/479 of query aligns to 10:464/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R341), T337 (≠ S345), K348 (= K355), Y379 (≠ F388), H381 (= H390), H388 (= H397), H423 (= H437)
- binding flavin-adenine dinucleotide: W39 (= W49), P75 (= P85), Q76 (≠ S86), G77 (= G87), G78 (= G88), N79 (≠ R89), T80 (= T90), G81 (= G91), M82 (≠ L92), G85 (= G95), S86 (≠ A96), L139 (≠ F149), G140 (≠ A150), A141 (≠ S151), C145 (≠ S155), G149 (= G159), N150 (= N160), A152 (≠ S162), T153 (= T163), G157 (= G167), G207 (= G217), I212 (= I222), E422 (= E436), N459 (= N473)
- binding zinc ion: H381 (= H390), H388 (= H397), E422 (= E436)
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
33% identity, 97% coverage: 15:478/479 of query aligns to 10:464/466 of 6lpuA
- binding flavin-adenine dinucleotide: W39 (= W49), P75 (= P85), G77 (= G87), G78 (= G88), N79 (≠ R89), T80 (= T90), G81 (= G91), G85 (= G95), S86 (≠ A96), L139 (≠ F149), G140 (≠ A150), A141 (≠ S151), C145 (≠ S155), H146 (≠ Q156), G148 (= G158), G149 (= G159), N150 (= N160), A152 (≠ S162), T153 (= T163), A155 (= A165), E206 (= E216), G207 (= G217), I211 (≠ F221), I212 (= I222), E422 (= E436), N459 (= N473)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R341), T337 (≠ S345), K348 (= K355), Y379 (≠ F388), H381 (= H390), H388 (= H397), H423 (= H437)
- binding zinc ion: H381 (= H390), H388 (= H397), E422 (= E436)
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
33% identity, 97% coverage: 15:478/479 of query aligns to 10:464/466 of 6lpqA
- binding flavin-adenine dinucleotide: W39 (= W49), P75 (= P85), G77 (= G87), G78 (= G88), N79 (≠ R89), T80 (= T90), G81 (= G91), G85 (= G95), S86 (≠ A96), L139 (≠ F149), G140 (≠ A150), A141 (≠ S151), C145 (≠ S155), H146 (≠ Q156), G149 (= G159), N150 (= N160), A152 (≠ S162), T153 (= T163), A155 (= A165), G157 (= G167), E206 (= E216), G207 (= G217), I211 (≠ F221), I212 (= I222), E422 (= E436), N459 (= N473)
- binding d-malate: M82 (≠ L92), R333 (= R341), T337 (≠ S345), K348 (= K355), Y379 (≠ F388), H381 (= H390), H388 (= H397), E422 (= E436), H423 (= H437)
- binding zinc ion: H381 (= H390), H388 (= H397), E422 (= E436)
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
33% identity, 97% coverage: 15:478/479 of query aligns to 10:464/466 of 6lppA
- binding (2R)-2-hydroxypentanedioic acid: R333 (= R341), T337 (≠ S345), K348 (= K355), Y379 (≠ F388), H381 (= H390), H388 (= H397), N390 (= N399), H423 (= H437)
- binding flavin-adenine dinucleotide: W39 (= W49), P75 (= P85), G77 (= G87), G78 (= G88), N79 (≠ R89), T80 (= T90), G81 (= G91), M82 (≠ L92), G85 (= G95), S86 (≠ A96), L139 (≠ F149), G140 (≠ A150), A141 (≠ S151), C145 (≠ S155), G149 (= G159), N150 (= N160), A152 (≠ S162), T153 (= T163), A155 (= A165), G157 (= G167), G207 (= G217), I212 (= I222), E422 (= E436), H423 (= H437)
- binding zinc ion: H381 (= H390), H388 (= H397), E422 (= E436)
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
33% identity, 97% coverage: 15:478/479 of query aligns to 63:517/521 of Q8N465
- S109 (≠ T66) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ V84) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (= G88) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ V104) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (= M110) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ V129) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (= P146) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (≠ S162) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ G188) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G190) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (≠ S330) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R341) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (≠ S345) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (≠ P353) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (= K355) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (≠ D373) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (≠ Y380) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H390) binding ; mutation to A: Loss of catalytic activity.
- G436 (= G392) to V: slight reduction in catalytic activity
- N439 (= N395) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H397) binding ; mutation to A: Loss of catalytic activity.
- N443 (= N399) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (≠ I400) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (vs. gap) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E436) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H437) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (= G438) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
P39976 D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3; D-2HG--pyruvate transhydrogenase DLD3; (R)-2-hydroxyglutarate--pyruvate transhydrogenase; D-lactate dehydrogenase [cytochrome] 3; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
33% identity, 91% coverage: 39:476/479 of query aligns to 50:494/496 of P39976
Sites not aligning to the query:
- 17 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
31% identity, 86% coverage: 65:477/479 of query aligns to 53:463/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ P85), G75 (= G87), S76 (≠ G88), G77 (≠ R89), T78 (= T90), G79 (= G91), L80 (= L92), A83 (≠ G95), C84 (≠ A96), P137 (≠ A150), G138 (≠ S151), E139 (≠ A152), A142 (≠ S155), T143 (≠ Q156), G146 (= G159), N147 (= N160), S149 (= S162), T150 (= T163), A152 (= A165), G153 (= G166), E203 (= E216), G204 (= G217), I209 (= I222), E422 (= E436), H423 (= H437)
- binding fe (iii) ion: H377 (= H390), H384 (= H397), E422 (= E436)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
30% identity, 93% coverage: 35:478/479 of query aligns to 17:456/459 of P9WIT1
- K354 (≠ G367) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
28% identity, 97% coverage: 15:478/479 of query aligns to 2:455/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R341), W322 (≠ S345), H369 (= H390), H376 (= H397), H414 (= H437)
- binding flavin-adenine dinucleotide: P68 (= P85), G70 (= G87), T71 (≠ G88), G72 (≠ R89), T73 (= T90), G74 (= G91), G78 (= G95), V79 (≠ A96), L90 (≠ F107), P132 (≠ F149), G133 (≠ A150), A134 (≠ S151), G140 (= G159), M141 (≠ N160), A143 (≠ S162), T144 (= T163), A146 (= A165), S147 (≠ G166), E200 (= E216), G201 (= G217), I206 (= I222), W322 (≠ S345), E413 (= E436), N450 (= N473)
- binding manganese (ii) ion: H369 (= H390), H376 (= H397), E413 (= E436)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
28% identity, 97% coverage: 15:478/479 of query aligns to 2:454/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L92), R317 (= R341), W321 (≠ S345), H368 (= H390), H375 (= H397), H413 (= H437)
- binding flavin-adenine dinucleotide: P68 (= P85), G70 (= G87), T71 (≠ G88), G72 (≠ R89), T73 (= T90), G74 (= G91), G78 (= G95), V79 (≠ A96), L90 (≠ F107), P132 (≠ F149), G133 (≠ A150), A134 (≠ S151), G140 (= G159), M141 (≠ N160), A143 (≠ S162), T144 (= T163), A146 (= A165), S147 (≠ G166), E200 (= E216), G201 (= G217), I206 (= I222), W321 (≠ S345), Y322 (≠ E346), E412 (= E436), H413 (= H437), N449 (= N473)
- binding manganese (ii) ion: H368 (= H390), H375 (= H397), E412 (= E436)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
28% identity, 97% coverage: 15:478/479 of query aligns to 2:456/456 of 8jdsA
- binding flavin-adenine dinucleotide: E32 (≠ W49), P68 (= P85), G70 (= G87), T71 (≠ G88), G72 (≠ R89), T73 (= T90), G74 (= G91), G78 (= G95), V79 (≠ A96), L90 (≠ F107), P132 (≠ F149), G133 (≠ A150), A134 (≠ S151), G140 (= G159), M141 (≠ N160), A143 (≠ S162), T144 (= T163), A146 (= A165), S147 (≠ G166), E200 (= E216), G201 (= G217), I206 (= I222), W323 (≠ S345), E414 (= E436), H415 (= H437), N451 (= N473)
- binding manganese (ii) ion: H370 (= H390), H377 (= H397), E414 (= E436)
- binding pyruvic acid: R319 (= R341), H370 (= H390), H377 (= H397), H415 (= H437)
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
28% identity, 97% coverage: 15:478/479 of query aligns to 2:455/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (= P85), G70 (= G87), T71 (≠ G88), G72 (≠ R89), T73 (= T90), G74 (= G91), G78 (= G95), V79 (≠ A96), L90 (≠ F107), P132 (≠ F149), G133 (≠ A150), A134 (≠ S151), G140 (= G159), M141 (≠ N160), A143 (≠ S162), T144 (= T163), A146 (= A165), S147 (≠ G166), E200 (= E216), G201 (= G217), I206 (= I222), H369 (= H390), E413 (= E436), N450 (= N473)
- binding deaminohydroxyvaline: R319 (= R341), H414 (= H437)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
28% identity, 97% coverage: 15:478/479 of query aligns to 2:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R341), H369 (= H390), H376 (= H397), H414 (= H437)
- binding flavin-adenine dinucleotide: P68 (= P85), G70 (= G87), T71 (≠ G88), G72 (≠ R89), T73 (= T90), G74 (= G91), G78 (= G95), V79 (≠ A96), L90 (≠ F107), P132 (≠ F149), G133 (≠ A150), A134 (≠ S151), G140 (= G159), M141 (≠ N160), A143 (≠ S162), T144 (= T163), A146 (= A165), S147 (≠ G166), E200 (= E216), G201 (= G217), I206 (= I222), W322 (≠ S345), E413 (= E436), H414 (= H437), N450 (= N473)
- binding manganese (ii) ion: H369 (= H390), H376 (= H397), E413 (= E436)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
28% identity, 97% coverage: 15:478/479 of query aligns to 2:455/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (= P85), G70 (= G87), T71 (≠ G88), G72 (≠ R89), T73 (= T90), G74 (= G91), G78 (= G95), V79 (≠ A96), L90 (≠ F107), P132 (≠ F149), G133 (≠ A150), A134 (≠ S151), G140 (= G159), M141 (≠ N160), A143 (≠ S162), T144 (= T163), A146 (= A165), S147 (≠ G166), E200 (= E216), G201 (= G217), I206 (= I222), W322 (≠ S345), E413 (= E436), H414 (= H437), N450 (= N473)
- binding lactic acid: R318 (= R341), H369 (= H390), H376 (= H397), H414 (= H437)
- binding manganese (ii) ion: H369 (= H390), H376 (= H397), E413 (= E436)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
28% identity, 97% coverage: 15:478/479 of query aligns to 2:456/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (= P85), G70 (= G87), T71 (≠ G88), G72 (≠ R89), T73 (= T90), G74 (= G91), G78 (= G95), V79 (≠ A96), L90 (≠ F107), P132 (≠ F149), G133 (≠ A150), A134 (≠ S151), G140 (= G159), M141 (≠ N160), A143 (≠ S162), T144 (= T163), A146 (= A165), S147 (≠ G166), E200 (= E216), G201 (= G217), I206 (= I222), Y324 (≠ E346), H370 (= H390), E414 (= E436), N451 (= N473)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R341), W323 (≠ S345), H415 (= H437)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
28% identity, 97% coverage: 15:478/479 of query aligns to 2:456/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R341), W323 (≠ S345), H370 (= H390), H415 (= H437)
- binding flavin-adenine dinucleotide: P68 (= P85), G70 (= G87), T71 (≠ G88), G72 (≠ R89), T73 (= T90), G74 (= G91), G78 (= G95), V79 (≠ A96), L90 (≠ F107), P132 (≠ F149), G133 (≠ A150), A134 (≠ S151), G140 (= G159), M141 (≠ N160), A143 (≠ S162), T144 (= T163), A146 (= A165), S147 (≠ G166), E200 (= E216), G201 (= G217), I206 (= I222), H370 (= H390), E414 (= E436), N451 (= N473)
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
28% identity, 97% coverage: 15:478/479 of query aligns to 2:456/456 of 8jdoA
- binding (2R)-2-hydroxyhexanoic acid: R319 (= R341), W323 (≠ S345), H415 (= H437)
- binding flavin-adenine dinucleotide: P68 (= P85), G70 (= G87), T71 (≠ G88), G72 (≠ R89), T73 (= T90), G74 (= G91), G78 (= G95), V79 (≠ A96), L90 (≠ F107), P132 (≠ F149), G133 (≠ A150), A134 (≠ S151), G140 (= G159), M141 (≠ N160), A143 (≠ S162), T144 (= T163), A146 (= A165), S147 (≠ G166), E200 (= E216), G201 (= G217), I206 (= I222), Y324 (≠ E346), H370 (= H390), E414 (= E436), N451 (= N473)
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
28% identity, 97% coverage: 15:478/479 of query aligns to 2:456/456 of 8jdnA
- binding flavin-adenine dinucleotide: P68 (= P85), G70 (= G87), T71 (≠ G88), G72 (≠ R89), T73 (= T90), G74 (= G91), G78 (= G95), V79 (≠ A96), L90 (≠ F107), P132 (≠ F149), G133 (≠ A150), A134 (≠ S151), G140 (= G159), M141 (≠ N160), A143 (≠ S162), T144 (= T163), A146 (= A165), S147 (≠ G166), E200 (= E216), G201 (= G217), I206 (= I222), H370 (= H390), E414 (= E436), N451 (= N473)
- binding (2R)-2-oxidanylpentanoic acid: R319 (= R341), W323 (≠ S345), H415 (= H437)
Query Sequence
>GFF2609 FitnessBrowser__Marino:GFF2609
MLRPKPDETEKFMNSEQIIASLKDLMATGDAPGKVLTDPADLDTYGKDWTKIYPPKPLAI
ALPKTTEQVQALVKFANENQVALVPSGGRTGLSAGAVAANGEVVVAFDNMNQILDFNASD
RTVRCQAGVVTEQLQNCAEDNGLYYPVDFASAGSSQLGGNLSTNAGGIKVIRYGMSRDWV
AGLKVVTGKGDILDLNKDLEKNNTGYDLRHLFIGAEGTLGFITEATMKLSRKPDNLTVLV
LGLNDLTNTMDVLQTFQKKIDLTAYEFFSHQAMGHVLAHGQVQAPFETEAPYYALLEFES
VSDQVMDDAMALFEQCVENGWVLDGVISQSETQAQNLWQLRERISESIAPRTPYKNDISV
VVSKVPGFLQEIDAVVTEHYPDFEIIWFGHIGDGNLHLNILKPEDMANEDFFEKCQQVNK
WVFEIVERYQGSVSAEHGVGMTKKPYLQYTRSEAEIAYLRGIKQVFDPNGIMNPGKIFD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory