SitesBLAST
Comparing GFF2616 PGA1_c26570 putative glyoxylate/hydroxypyruvate reductase A to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5vg6B Crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from xanthobacter autotrophicus py2 in complex with NADPH and mes.
44% identity, 90% coverage: 32:308/308 of query aligns to 37:315/315 of 5vg6B
- active site: M98 (≠ L93), R230 (= R223), D254 (= D247), E259 (= E252), H278 (= H271)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A74 (= A70), R92 (= R87), M102 (= M97), L147 (= L140), G148 (= G141), D149 (≠ A142), L150 (= L143), W168 (= W161), S169 (= S162), R170 (= R163), T171 (≠ S164), K173 (= K166), L201 (= L194), P202 (= P195), T207 (= T200), V228 (≠ P221), R230 (= R223), H278 (= H271), A280 (= A273), S281 (≠ A274), Y315 (= Y308)
4zqbB Crystal structure of NADP-dependent dehydrogenase from rhodobactersphaeroides in complex with NADP and sulfate
43% identity, 87% coverage: 41:308/308 of query aligns to 47:316/316 of 4zqbB
- active site: L99 (= L93), R231 (= R223), E260 (= E252), H279 (= H271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R93 (= R87), M103 (= M97), G147 (= G139), L148 (= L140), G149 (= G141), E150 (≠ A142), L151 (= L143), W169 (= W161), S170 (= S162), R171 (= R163), S172 (= S164), K174 (= K166), L202 (= L194), P203 (= P195), F229 (≠ P221), R231 (= R223), H279 (= H271), S281 (≠ A273), A282 (= A274), Y316 (= Y308)
3kboA 2.14 angstrom crystal structure of putative oxidoreductase (ycdw) from salmonella typhimurium in complex with NADP
40% identity, 81% coverage: 61:308/308 of query aligns to 56:312/312 of 3kboA
- active site: M95 (≠ L93), R227 (= R223), E256 (= E252), H275 (= H271)
- binding N-(2-hydroxyethyl)-N,N-dimethyl-3-sulfopropan-1-aminium: R56 (= R61)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R89 (= R87), M99 (= M97), G143 (= G139), A144 (≠ L140), G145 (= G141), V146 (≠ A142), L147 (= L143), W165 (= W161), S166 (= S162), R167 (= R163), S168 (= S164), K170 (= K166), L197 (= L193), P199 (= P195), L225 (≠ P221), A226 (≠ G222), R227 (= R223), D251 (= D247), H275 (= H271), A278 (= A274), Y312 (= Y308)
Sites not aligning to the query:
7jqiA Structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with alpha-ketoglutarate and NADP+
39% identity, 80% coverage: 63:308/308 of query aligns to 58:312/312 of 7jqiA
- binding 2-oxoglutaric acid: G64 (≠ W69), A65 (= A70), G66 (= G71), R227 (= R223), H275 (= H271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A65 (= A70), R89 (= R87), M99 (= M97), A144 (≠ L140), G145 (= G141), V146 (≠ A142), L147 (= L143), W165 (= W161), S166 (= S162), R167 (= R163), T168 (≠ S164), K170 (= K166), L198 (= L194), P199 (= P195), L225 (≠ P221), R227 (= R223), H275 (= H271), A278 (= A274), Y312 (= Y308)
6p35A 2.5 angstrom structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with 2-keto arginine and NADP
39% identity, 80% coverage: 63:308/308 of query aligns to 58:312/312 of 6p35A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A65 (= A70), R89 (= R87), M99 (= M97), A144 (≠ L140), G145 (= G141), V146 (≠ A142), L147 (= L143), W165 (= W161), S166 (= S162), R167 (= R163), T168 (≠ S164), K170 (= K166), L198 (= L194), P199 (= P195), L225 (≠ P221), R227 (= R223), H275 (= H271), A277 (= A273), A278 (= A274), Y312 (= Y308)
- binding 5-[(diaminomethylidene)amino]-2-oxopentanoic acid: A65 (= A70), R227 (= R223), H275 (= H271), T280 (= T276)
Sites not aligning to the query:
7jqhA Structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with phosphate and NADP+
39% identity, 80% coverage: 63:308/308 of query aligns to 59:313/313 of 7jqhA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A66 (= A70), R90 (= R87), M100 (= M97), A145 (≠ L140), G146 (= G141), V147 (≠ A142), L148 (= L143), W166 (= W161), S167 (= S162), R168 (= R163), T169 (≠ S164), K171 (= K166), L199 (= L194), P200 (= P195), L226 (≠ P221), A227 (≠ G222), R228 (= R223), D252 (= D247), H276 (= H271), A279 (= A274), Y313 (= Y308)
5tsdA Crystal structure of NADPH-dependent 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADPH and oxalate
34% identity, 94% coverage: 20:308/308 of query aligns to 19:316/316 of 5tsdA
- active site: E260 (= E252), H279 (= H271)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A71 (= A70), R89 (= R87), M99 (= M97), G143 (= G139), L144 (= L140), G145 (= G141), I146 (≠ A142), L147 (= L143), W165 (= W161), S166 (= S162), R167 (= R163), T168 (≠ S164), K170 (= K166), L197 (= L194), P198 (= P195), A229 (≠ P221), G230 (= G222), R231 (= R223), D255 (= D247), H279 (= H271), Y316 (= Y308)
- binding oxalic acid: W50 (≠ Y47), G70 (≠ W69), A71 (= A70), G72 (= G71), R231 (= R223), H279 (= H271)
5bqfA Probable 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADP, hepes and l(+)-tartaric acid
34% identity, 94% coverage: 20:308/308 of query aligns to 20:317/317 of 5bqfA
- active site: E261 (= E252), H280 (= H271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A72 (= A70), R90 (= R87), M100 (= M97), G144 (= G139), L145 (= L140), G146 (= G141), I147 (≠ A142), L148 (= L143), W166 (= W161), S167 (= S162), R168 (= R163), T169 (≠ S164), L198 (= L194), P199 (= P195), A230 (≠ P221), G231 (= G222), R232 (= R223), H280 (= H271), A283 (= A274), Y317 (= Y308)
4xcvA Probable 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADPH
34% identity, 94% coverage: 20:308/308 of query aligns to 20:317/317 of 4xcvA
- active site: E261 (= E252), H280 (= H271)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A72 (= A70), R90 (= R87), M100 (= M97), G144 (= G139), L145 (= L140), G146 (= G141), I147 (≠ A142), L148 (= L143), W166 (= W161), S167 (= S162), R168 (= R163), T169 (≠ S164), K171 (= K166), L198 (= L194), P199 (= P195), A230 (≠ P221), G231 (= G222), R232 (= R223), H280 (= H271), A283 (= A274), Y317 (= Y308)
4z0pA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
37% identity, 87% coverage: 42:308/308 of query aligns to 44:316/316 of 4z0pA
- active site: L95 (= L93), R231 (= R223), G250 (= G242), D255 (= D247), E260 (= E252), H279 (= H271)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R89 (= R87), M99 (= M97), M144 (≠ L140), G145 (= G141), V146 (≠ A142), L147 (= L143), W165 (= W161), S166 (= S162), R167 (= R163), S168 (= S164), R170 (≠ K166), L197 (= L194), P198 (= P195), A229 (≠ P221), G230 (= G222), R231 (= R223), H279 (= H271), A281 (= A273), A282 (= A274), Y316 (= Y308)
- binding oxalic acid: W50 (≠ Y47), G70 (≠ W69), A71 (= A70), G72 (= G71), H114 (≠ D113), R115 (= R114), R231 (= R223), H279 (= H271)
4weqA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in complex with NADP and sulfate (see paper)
37% identity, 87% coverage: 42:308/308 of query aligns to 44:316/316 of 4weqA
- active site: L95 (= L93), R231 (= R223), G250 (= G242), D255 (= D247), E260 (= E252), H279 (= H271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R89 (= R87), M99 (= M97), M144 (≠ L140), G145 (= G141), V146 (≠ A142), L147 (= L143), W165 (= W161), S166 (= S162), R167 (= R163), S168 (= S164), R170 (≠ K166), L197 (= L194), P198 (= P195), A229 (≠ P221), G230 (= G222), R231 (= R223), D255 (= D247), H279 (= H271), A281 (= A273), Y316 (= Y308)
5mh6A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-ketohexanoic acid and NAD+ (1.35 a resolution)
37% identity, 65% coverage: 92:291/308 of query aligns to 90:294/306 of 5mh6A
- binding 2-Ketohexanoic acid: R224 (= R223), H272 (= H271), Y280 (≠ L279)
- binding magnesium ion: T130 (≠ V126), A132 (= A130), F210 (≠ L209), E211 (≠ A210), M213 (≠ L212), G225 (= G224), P226 (= P225), V228 (≠ I227), E230 (≠ D229), D241 (≠ Q240), S251 (≠ R250)
- binding nicotinamide-adenine-dinucleotide: G142 (= G141), T143 (≠ A142), L144 (= L143), R164 (= R163), P196 (= P195), T201 (= T200), V222 (≠ P221), A223 (≠ G222), R224 (= R223), H272 (= H271), S274 (≠ A273)
Sites not aligning to the query:
5mhaB D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
37% identity, 65% coverage: 92:291/308 of query aligns to 92:296/308 of 5mhaB
- binding 2-Ketohexanoic acid: R226 (= R223), H274 (= H271), Y282 (≠ L279)
- binding (2R)-2-hydroxyhexanoic acid: Y282 (≠ L279)
- binding magnesium ion: F212 (≠ L209), E213 (≠ A210), M215 (≠ L212), D243 (≠ Q240)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L143 (= L140), G144 (= G141), T145 (≠ A142), L146 (= L143), R165 (≠ S162), R166 (= R163), S167 (= S164), P180 (≠ D177), T197 (≠ L194), P198 (= P195), T203 (= T200), V224 (≠ P221), A225 (≠ G222), R226 (= R223), H274 (= H271), S276 (≠ A273)
Sites not aligning to the query:
5mhaA D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
37% identity, 65% coverage: 92:291/308 of query aligns to 92:296/308 of 5mhaA
- binding 2-Ketohexanoic acid: R226 (= R223), H274 (= H271), Y282 (≠ L279)
- binding magnesium ion: T132 (≠ V126), A134 (= A130)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L143 (= L140), G144 (= G141), T145 (≠ A142), L146 (= L143), R165 (≠ S162), R166 (= R163), S167 (= S164), P180 (≠ D177), T197 (≠ L194), P198 (= P195), T203 (= T200), V224 (≠ P221), A225 (≠ G222), R226 (= R223), H274 (= H271), S276 (≠ A273)
Sites not aligning to the query:
5mh5A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-keto-hexanoic acid and NADP+ (1.4 a resolution)
37% identity, 65% coverage: 92:291/308 of query aligns to 92:296/308 of 5mh5A
- binding 2-Ketohexanoic acid: R226 (= R223), H274 (= H271), Y282 (≠ L279)
- binding magnesium ion: T132 (≠ V126), A134 (= A130), F212 (≠ L209), E213 (≠ A210), M215 (≠ L212), D243 (≠ Q240)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G142 (= G139), L143 (= L140), G144 (= G141), T145 (≠ A142), L146 (= L143), R165 (≠ S162), R166 (= R163), S167 (= S164), T197 (≠ L194), P198 (= P195), T203 (= T200), V224 (≠ P221), A225 (≠ G222), R226 (= R223), H274 (= H271), S276 (≠ A273)
Sites not aligning to the query:
4e5pA Thermostable phosphite dehydrogenase a176r variant in complex with nad (see paper)
34% identity, 55% coverage: 135:304/308 of query aligns to 148:327/332 of 4e5pA
- active site: R237 (= R223), D261 (= D247), E266 (= E252), H292 (= H271)
- binding nicotinamide-adenine-dinucleotide: G154 (= G141), A155 (= A142), I156 (≠ L143), A175 (≠ S164), R176 (≠ K165), L208 (= L194), P209 (= P195), T214 (= T200), P235 (= P221), C236 (≠ G222), R237 (= R223), H292 (= H271)
Sites not aligning to the query:
4e5mA Thermostable phosphite dehydrogenase e175a/a176r in complex with NADP (see paper)
34% identity, 55% coverage: 135:304/308 of query aligns to 148:327/329 of 4e5mA
- active site: R237 (= R223), D261 (= D247), E266 (= E252), H292 (= H271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G154 (= G141), A155 (= A142), I156 (≠ L143), R176 (≠ K165), L208 (= L194), P209 (= P195), T214 (= T200), P235 (= P221), C236 (≠ G222), R237 (= R223), H292 (= H271), G294 (≠ A273)
Sites not aligning to the query:
4e5kA Thermostable phosphite dehydrogenase in complex with NAD and sulfite (see paper)
34% identity, 55% coverage: 135:304/308 of query aligns to 148:327/329 of 4e5kA
- active site: R237 (= R223), D261 (= D247), E266 (= E252), H292 (= H271)
- binding nicotinamide-adenine-dinucleotide: G152 (= G139), G154 (= G141), A155 (= A142), I156 (≠ L143), H174 (≠ R163), E175 (≠ S164), A176 (≠ K165), A207 (≠ L193), L208 (= L194), P209 (= P195), P235 (= P221), C236 (≠ G222), R237 (= R223), D261 (= D247), H292 (= H271), G294 (≠ A273)
- binding sulfite ion: R237 (= R223), H292 (= H271)
Sites not aligning to the query:
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
42% identity, 31% coverage: 180:276/308 of query aligns to 187:283/304 of 1wwkA
- active site: R230 (= R223), D254 (= D247), E259 (= E252), H278 (= H271)
- binding nicotinamide-adenine-dinucleotide: V201 (≠ L194), P202 (= P195), T207 (= T200), T228 (≠ P221), S229 (≠ G222), D254 (= D247), H278 (= H271), G280 (≠ A273)
Sites not aligning to the query:
5v6qB Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and malonate (see paper)
35% identity, 51% coverage: 119:276/308 of query aligns to 124:282/319 of 5v6qB
- active site: R230 (= R223), D254 (= D247), E259 (= E252), H277 (= H271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: F148 (≠ L138), L150 (= L140), G151 (= G141), R152 (≠ A142), I153 (≠ L143), T172 (≠ S162), R173 (= R163), V201 (≠ L194), P202 (= P195), S206 (≠ A199), T207 (= T200), V228 (≠ P221), G229 (= G222), R230 (= R223), H277 (= H271), A279 (= A273)
Sites not aligning to the query:
Query Sequence
>GFF2616 PGA1_c26570 putative glyoxylate/hydroxypyruvate reductase A
MINVQFAALPERWATYETPLRAAFAEAGLKVDLRLDHTPDEVDYVVYAPNSDLQDFTPYT
RCKAVLSLWAGVEKIVGNRTLTMPLCRMVDPGLTAGMVEWVTGHVLRYHLNIDRTIHTQD
RWEPVVPPLAEERPVTVLGLGALGQACASMLATLGFPVTGWSRSKKSIDGITCRHGDDGL
RDALATAQIVILLLPDTHATENTLNSDTLALLPKGARIINPGRGPLIDDDALLAALDSGQ
IGHATLDVFRIEPLPMDHPYWAHPRVTVTPHIAAETRPLTAARVIADNIRRGEAEAPFLH
QVDRTLGY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory