SitesBLAST
Comparing GFF262 PS417_01335 hypothetical protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6torB Human o-phosphoethanolamine phospho-lyase (see paper)
41% identity, 41% coverage: 564:962/966 of query aligns to 2:394/404 of 6torB
5g4jA Phospholyase a1rdf1 from arthrobacter in complex with phosphoethanolamine (see paper)
33% identity, 43% coverage: 543:958/966 of query aligns to 2:414/423 of 5g4jA
- active site: S14 (≠ Q555), Y130 (= Y671), D201 (≠ E745), D234 (= D778), Q237 (= Q781), K264 (= K808), T294 (≠ S838), K395 (= K939)
- binding {5-hydroxy-6-methyl-4-[(E)-{[2-(phosphonooxy)ethyl]imino}methyl]pyridin-3-yl}methyl dihydrogen phosphate: Y44 (≠ L585), R73 (= R614), G103 (= G644), S104 (≠ T645), Y130 (= Y671), H131 (= H672), D234 (= D778), V236 (= V780), Q237 (= Q781), K264 (= K808), T294 (≠ S838), R397 (≠ K941)
5g4iA Plp-dependent phospholyase a1rdf1 from arthrobacter aurescens tc1 (see paper)
33% identity, 43% coverage: 543:958/966 of query aligns to 2:414/423 of 5g4iA
- active site: S14 (≠ Q555), Y130 (= Y671), D201 (≠ E745), D234 (= D778), Q237 (= Q781), K264 (= K808), T294 (≠ S838), K395 (= K939)
- binding pyridoxal-5'-phosphate: G103 (= G644), S104 (≠ T645), H131 (= H672), D234 (= D778), V236 (= V780), Q237 (= Q781), K264 (= K808)
- binding phosphate ion: Y44 (≠ L585), R397 (≠ K941)
1zobA Crystal structure of dialkylglycine decarboxylases bound with calcium ion
31% identity, 43% coverage: 548:966/966 of query aligns to 4:431/431 of 1zobA
- active site: G19 (vs. gap), W136 (≠ Y671), E208 (= E745), D241 (= D778), Q244 (= Q781), K270 (= K808), T301 (≠ S838), R404 (≠ K939)
- binding calcium ion: L76 (≠ T611), S78 (= S613), V303 (≠ G840), S304 (≠ G841), D305 (≠ S842)
- binding pyridoxal-5'-phosphate: T108 (≠ S643), A110 (≠ T645), N113 (= N648), W136 (≠ Y671), H137 (= H672), E208 (= E745), D241 (= D778), A243 (≠ V780), Q244 (= Q781), K270 (= K808)
1zc9A The crystal structure of dialkylglycine decarboxylase complex with pyridoxamine 5-phosphate (see paper)
31% identity, 43% coverage: 548:966/966 of query aligns to 4:431/431 of 1zc9A
- active site: G19 (vs. gap), W136 (≠ Y671), E208 (= E745), D241 (= D778), Q244 (= Q781), K270 (= K808), T301 (≠ S838), R404 (≠ K939)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G109 (= G644), A110 (≠ T645), W136 (≠ Y671), H137 (= H672), E208 (= E745), D241 (= D778), A243 (≠ V780), Q244 (= Q781), K270 (= K808)
1m0qA Structure of dialkylglycine decarboxylase complexed with s-1- aminoethanephosphonate (see paper)
31% identity, 43% coverage: 548:966/966 of query aligns to 4:431/431 of 1m0qA
- active site: G19 (vs. gap), W136 (≠ Y671), E208 (= E745), D241 (= D778), Q244 (= Q781), K270 (= K808), T301 (≠ S838), R404 (≠ K939)
- binding (1s)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]ethylphosphonic acid: Q50 (vs. gap), T108 (≠ S643), A110 (≠ T645), W136 (≠ Y671), H137 (= H672), E208 (= E745), S213 (≠ N750), D241 (= D778), A243 (≠ V780), Q244 (= Q781), K270 (= K808), R404 (≠ K939)
1m0pA Structure of dialkylglycine decarboxylase complexed with 1-amino-1- phenylethanephosphonate (see paper)
31% identity, 43% coverage: 548:966/966 of query aligns to 4:431/431 of 1m0pA
- active site: G19 (vs. gap), W136 (≠ Y671), E208 (= E745), D241 (= D778), Q244 (= Q781), K270 (= K808), T301 (≠ S838), R404 (≠ K939)
- binding (1r)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]-1-phenylethylphosphonic acid: Q50 (vs. gap), T108 (≠ S643), A110 (≠ T645), W136 (≠ Y671), H137 (= H672), E208 (= E745), S213 (≠ N750), D241 (= D778), A243 (≠ V780), Q244 (= Q781), K270 (= K808), R404 (≠ K939)
1m0oA Structure of dialkylglycine decarboxylase complexed with 1-amino-1- methylpropanephosphonate (see paper)
31% identity, 43% coverage: 548:966/966 of query aligns to 4:431/431 of 1m0oA
- active site: G19 (vs. gap), W136 (≠ Y671), E208 (= E745), D241 (= D778), Q244 (= Q781), K270 (= K808), T301 (≠ S838), R404 (≠ K939)
- binding (1r)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]-1-methylpropylphosphonic acid: Q50 (vs. gap), G109 (= G644), A110 (≠ T645), W136 (≠ Y671), H137 (= H672), E208 (= E745), D241 (= D778), Q244 (= Q781), K270 (= K808), R404 (≠ K939)
1m0nA Structure of dialkylglycine decarboxylase complexed with 1- aminocyclopentanephosphonate (see paper)
31% identity, 43% coverage: 548:966/966 of query aligns to 4:431/431 of 1m0nA
- active site: G19 (vs. gap), W136 (≠ Y671), E208 (= E745), D241 (= D778), Q244 (= Q781), K270 (= K808), T301 (≠ S838), R404 (≠ K939)
- binding 1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]cyclopentylphosphonic acid: Q50 (vs. gap), M51 (vs. gap), A110 (≠ T645), N113 (= N648), W136 (≠ Y671), H137 (= H672), E208 (= E745), S213 (≠ N750), D241 (= D778), A243 (≠ V780), Q244 (= Q781), K270 (= K808), R404 (≠ K939)
1dgdA An alkali metal ion size-dependent switch in the active site structure of dialkylglycine decarboxylase (see paper)
31% identity, 43% coverage: 548:966/966 of query aligns to 4:431/431 of 1dgdA
- active site: G19 (vs. gap), W136 (≠ Y671), E208 (= E745), D241 (= D778), Q244 (= Q781), K270 (= K808), T301 (≠ S838), R404 (≠ K939)
- binding pyridoxal-5'-phosphate: T108 (≠ S643), G109 (= G644), A110 (≠ T645), W136 (≠ Y671), H137 (= H672), E208 (= E745), D241 (= D778), A243 (≠ V780), Q244 (= Q781), K270 (= K808)
1d7vA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with nma (see paper)
31% identity, 43% coverage: 548:966/966 of query aligns to 4:431/431 of 1d7vA
- active site: G19 (vs. gap), W136 (≠ Y671), E208 (= E745), D241 (= D778), Q244 (= Q781), K270 (= K808), T301 (≠ S838), R404 (≠ K939)
- binding potassium ion: H75 (vs. gap), L76 (≠ T611), F77 (≠ N612), S78 (= S613), T301 (≠ S838), H302 (≠ S839), V303 (≠ G840), S304 (≠ G841), D305 (≠ S842)
- binding n-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-2-methylalanine: A110 (≠ T645), W136 (≠ Y671), H137 (= H672), E208 (= E745), S213 (≠ N750), D241 (= D778), A243 (≠ V780), Q244 (= Q781), K270 (= K808), R404 (≠ K939)
1d7uA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with lcs (see paper)
31% identity, 43% coverage: 548:966/966 of query aligns to 4:431/431 of 1d7uA
- active site: G19 (vs. gap), W136 (≠ Y671), E208 (= E745), D241 (= D778), Q244 (= Q781), K270 (= K808), T301 (≠ S838), R404 (≠ K939)
- binding potassium ion: H75 (vs. gap), L76 (≠ T611), F77 (≠ N612), S78 (= S613), T301 (≠ S838), H302 (≠ S839), V303 (≠ G840), S304 (≠ G841), D305 (≠ S842)
- binding [5-hydroxy-6-methyl-4-({[(4E)-3-oxo-1,2-oxazolidin-4-ylidene]amino}methyl)pyridin-3-yl]methyl dihydrogen phosphate: G109 (= G644), A110 (≠ T645), W136 (≠ Y671), H137 (= H672), E208 (= E745), D241 (= D778), A243 (≠ V780), Q244 (= Q781), K270 (= K808), R404 (≠ K939)
1d7sA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with dcs (see paper)
31% identity, 43% coverage: 548:966/966 of query aligns to 4:431/431 of 1d7sA
- active site: G19 (vs. gap), W136 (≠ Y671), E208 (= E745), D241 (= D778), Q244 (= Q781), K270 (= K808), T301 (≠ S838), R404 (≠ K939)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: Q50 (vs. gap), G109 (= G644), A110 (≠ T645), W136 (≠ Y671), H137 (= H672), E208 (= E745), D241 (= D778), A243 (≠ V780), Q244 (= Q781), K270 (= K808), R404 (≠ K939)
- binding potassium ion: H75 (vs. gap), L76 (≠ T611), F77 (≠ N612), S78 (= S613), T301 (≠ S838), H302 (≠ S839), V303 (≠ G840), S304 (≠ G841), D305 (≠ S842)
1d7rA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with 5pa (see paper)
31% identity, 43% coverage: 548:966/966 of query aligns to 4:431/431 of 1d7rA
- active site: G19 (vs. gap), W136 (≠ Y671), E208 (= E745), D241 (= D778), Q244 (= Q781), K270 (= K808), T301 (≠ S838), R404 (≠ K939)
- binding n-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-y-lmethyl]-1-amino-cyclopropanecarboxylic acid: G109 (= G644), A110 (≠ T645), W136 (≠ Y671), H137 (= H672), E208 (= E745), S213 (≠ N750), D241 (= D778), A243 (≠ V780), Q244 (= Q781), K270 (= K808), R404 (≠ K939)
- binding potassium ion: H75 (vs. gap), L76 (≠ T611), F77 (≠ N612), S78 (= S613), T301 (≠ S838), H302 (≠ S839), V303 (≠ G840), S304 (≠ G841), D305 (≠ S842)
5wyaA Structure of amino acid racemase, 2.65 a (see paper)
30% identity, 42% coverage: 543:952/966 of query aligns to 8:419/439 of 5wyaA
- active site: A20 (≠ Q555), Y140 (= Y671), E215 (= E745), D248 (= D778), N251 (≠ Q781), K278 (= K808), T307 (≠ S837), R406 (≠ K939)
- binding (2S,3S)-3-methyl-2-[[2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methylamino]pentanoic acid: A52 (≠ V588), Y82 (≠ R614), S112 (= S643), G113 (= G644), S114 (≠ T645), Y140 (= Y671), H141 (= H672), E215 (= E745), D248 (= D778), V250 (= V780), N251 (≠ Q781), K278 (= K808), F306 (= F836), T307 (≠ S837), R406 (≠ K939)
5wyfA Structure of amino acid racemase, 2.12 a (see paper)
30% identity, 42% coverage: 543:952/966 of query aligns to 10:421/446 of 5wyfA
- active site: A22 (≠ Q555), Y142 (= Y671), E217 (= E745), D250 (= D778), N253 (≠ Q781), K280 (= K808), T309 (≠ S837), R408 (≠ K939)
- binding n-[o-phosphono-pyridoxyl]-isoleucine: A54 (≠ V588), Y84 (≠ R614), G115 (= G644), S116 (≠ T645), Y142 (= Y671), H143 (= H672), D222 (≠ N750), D250 (= D778), V252 (= V780), N253 (≠ Q781), K280 (= K808), F308 (= F836), T309 (≠ S837), R408 (≠ K939)
4ysnC Structure of aminoacid racemase in complex with plp (see paper)
30% identity, 42% coverage: 543:952/966 of query aligns to 17:428/448 of 4ysnC
- active site: A29 (≠ Q555), Y149 (= Y671), E224 (= E745), D257 (= D778), N260 (≠ Q781), K287 (= K808), T316 (≠ S837), R415 (≠ K939)
- binding pyridoxal-5'-phosphate: S121 (= S643), G122 (= G644), S123 (≠ T645), Y149 (= Y671), H150 (= H672), E224 (= E745), D257 (= D778), V259 (= V780), K287 (= K808), F315 (= F836), T316 (≠ S837)
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
30% identity, 44% coverage: 540:964/966 of query aligns to 4:444/451 of 6g4fA
- active site: Y15 (≠ F551), Y146 (= Y671), D253 (= D778), K282 (= K808)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: S112 (= S643), G113 (= G644), S114 (≠ T645), Y146 (= Y671), H147 (= H672), E220 (= E745), D253 (= D778), V255 (= V780), I256 (≠ Q781), K282 (= K808)
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
30% identity, 44% coverage: 540:964/966 of query aligns to 4:444/451 of 6g4eA
- active site: Y15 (≠ F551), Y146 (= Y671), D253 (= D778), K282 (= K808)
- binding 6-aminohexanoic acid: K282 (= K808), R412 (≠ Q929), M414 (≠ T931)
- binding pyridoxal-5'-phosphate: S112 (= S643), G113 (= G644), S114 (≠ T645), Y146 (= Y671), H147 (= H672), E220 (= E745), D253 (= D778), V255 (= V780), I256 (≠ Q781), K282 (= K808)
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
30% identity, 44% coverage: 540:964/966 of query aligns to 4:444/453 of 6g4dB
- active site: Y15 (≠ F551), Y146 (= Y671), D253 (= D778), K282 (= K808)
- binding pyridoxal-5'-phosphate: S112 (= S643), G113 (= G644), S114 (≠ T645), Y146 (= Y671), H147 (= H672), E220 (= E745), D253 (= D778), V255 (= V780), I256 (≠ Q781), K282 (= K808)
Query Sequence
>GFF262 PS417_01335 hypothetical protein
MPLATLIHRASLPCPQVGTDQVAQLLAQHYGLAGTLQSLGSQQDLNYRVDSPRGRFVLKI
CRGDYDAVELHAQHAALDRLQTVRVPKVIKSLTGEALLTLNLDGQALHVRVLEYIDGQPL
THLPHLGRGVIAGFGDLCGRMSQALARFEHPGLQRTLQWDPRHAQALIKHLLATLEKLPH
RLALEQVAEQVETRIRPLADHLPWQAVHMDITDDNVVWQRDAQRHWQIQGVIDFGDLLHT
WRIADLSVTCAALLHHADGDPFAILPAIQACHAVTPLQHEELLALWPLIVARAAVLVLSS
EQQQRLDPDNRYLLKNAEHEWEIFHVATSVPFALMEAAILGCVGQAPAPLASQGFAPLLP
GLVGREFALIDLGVLSPHFEAGNWEQPGVDQRLLQEAAAVHGLAASRYGQYRLSQTQPDS
AIEPETFPLHVELHVPLGTSVEAPFAGVVRPGANGGLQVHSSGASVWLWGMKALLQPGAA
VLKGQVIGEVEGPLIVQLCRADVPAPLFCTPSRAQAWQSLCPSPAALLGLACDAEPELDP
EALLARRDASFARSQKHYYADPPRIERGWRNHLIDMQGRSYLDMLNNVAVLGHGHPRMAA
VAARQWSLLNTNSRFHYAAVTEFSERLLALAPEGMDRVFLVNSGTEANDLAIRLAWAYSG
GRDMLSVLEAYHGWSVAADAVSTSIADNPQALSSRPDWVHPVTAPNTYRGEFRGQDSAPD
YVRSVEHNLAKIAASQRQLAGFICEPVYGNAGGISLPPGYLQQVYGLVRAQGGVCIADEV
QVGYGRMGHFFWGFEEQGVVPDIITMAKGMGNGQPLGAVITRREIAEALEAEGYFFSSSG
GSPVSCRIGMAVLDVMEEEKLWENARVVGGHFKARLEELIDRHPLVGAVHGSGFYLGLEL
VRDRQTLEPATEETTLLCDRLRELGIFMQPTGDYLNILKIKPPMVTSRHSVDFFVDMLSK
VLDEQL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory