SitesBLAST
Comparing GFF2642 FitnessBrowser__psRCH2:GFF2642 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1f9cA Crystal structure of mle d178n variant (see paper)
81% identity, 99% coverage: 5:372/373 of query aligns to 3:360/360 of 1f9cA
- active site: T41 (= T53), G44 (= G56), T129 (= T141), K155 (= K167), K157 (= K169), D186 (= D198), N188 (= N200), E212 (= E224), D237 (= D249), E238 (= E250), S239 (= S251), K261 (= K273), G288 (= G300), T289 (= T301), M290 (= M302), T314 (= T326), E315 (= E327), L316 (= L328)
- binding manganese (ii) ion: D186 (= D198), E212 (= E224), D237 (= D249)
3dgbA Crystal structure of muconate lactonizing enzyme from pseudomonas fluorescens complexed with muconolactone (see paper)
81% identity, 98% coverage: 6:372/373 of query aligns to 5:371/371 of 3dgbA
- active site: H21 (= H22), T52 (= T53), G55 (= G56), T140 (= T141), K166 (= K167), K168 (= K169), D197 (= D198), N199 (= N200), E223 (= E224), D248 (= D249), E249 (= E250), S250 (= S251), I251 (= I252), K272 (= K273), Y297 (= Y298), G299 (= G300), T300 (= T301), M301 (= M302), H313 (= H314), T325 (= T326), E326 (= E327), L327 (= L328)
- binding magnesium ion: D197 (= D198), E223 (= E224), D248 (= D249)
- binding [(2S)-5-oxo-2,5-dihydrofuran-2-yl]acetic acid: I53 (= I54), Y58 (= Y59), T140 (= T141), K166 (= K167), K168 (= K169), D197 (= D198), K272 (= K273), T300 (= T301), E326 (= E327), F328 (= F329)
3fcpA Crystal structure of muconate lactonizing enzyme from klebsiella pneumoniae
54% identity, 99% coverage: 6:373/373 of query aligns to 5:356/356 of 3fcpA
- active site: T41 (= T53), G44 (= G56), T129 (= T141), K151 (= K167), K153 (= K169), D182 (= D198), N184 (= N200), E208 (= E224), D233 (= D249), E234 (= E250), A235 (≠ S251), K257 (= K273), G284 (= G300), T285 (= T301), M286 (= M302), T309 (= T326), E310 (= E327), M311 (≠ L328)
- binding magnesium ion: N184 (= N200), D233 (= D249), E234 (= E250)
1nu5A Crystal structure of pseudomonas sp. P51 chloromuconate lactonizing enzyme (see paper)
41% identity, 98% coverage: 6:372/373 of query aligns to 3:368/369 of 1nu5A
- active site: L19 (≠ H22), S49 (≠ T52), G52 (= G55), T137 (= T141), K163 (= K167), K165 (= K169), E176 (≠ K180), D194 (= D198), N196 (= N200), E220 (= E224), D245 (= D249), E246 (= E250), S247 (= S251), K269 (= K273), G296 (= G300), T297 (= T301), M298 (= M302), C322 (≠ T326), E323 (= E327), L324 (= L328)
- binding manganese (ii) ion: D194 (= D198), E220 (= E224), T235 (≠ N239), N238 (≠ S242), D245 (= D249)
2chrA A re-evaluation of the crystal structure of chloromuconate cycloisomerase (see paper)
42% identity, 98% coverage: 6:372/373 of query aligns to 3:368/370 of 2chrA
- active site: I19 (≠ H22), S49 (≠ T53), G52 (= G56), T137 (= T141), K163 (= K167), K165 (= K169), D194 (= D198), N196 (= N200), E220 (= E224), D245 (= D249), E246 (= E250), S247 (= S251), S267 (≠ A271), K269 (= K273), G296 (= G300), T297 (= T301), M298 (= M302), C322 (≠ T326), E323 (= E327), L324 (= L328)
- binding manganese (ii) ion: D194 (= D198), E220 (= E224), D245 (= D249)
4m0xA Crystal structure of 2-chloromuconate cycloisomerase from rhodococcus opacus 1cp (see paper)
42% identity, 98% coverage: 6:372/373 of query aligns to 3:368/369 of 4m0xA
- active site: T50 (= T53), G53 (= G56), A138 (≠ T141), K163 (= K167), K165 (= K169), D194 (= D198), N196 (= N200), E220 (= E224), D245 (= D249), E246 (= E250), S247 (= S251), A267 (= A271), K269 (= K273), A296 (≠ G300), A297 (≠ T301), T298 (≠ M302), C322 (≠ T326), E323 (= E327), L324 (= L328)
- binding manganese (ii) ion: D194 (= D198), E220 (= E224), D245 (= D249)
3i4kA Crystal structure of muconate lactonizing enzyme from corynebacterium glutamicum
34% identity, 99% coverage: 4:372/373 of query aligns to 2:370/370 of 3i4kA
- active site: H20 (= H22), V51 (≠ T53), G54 (= G56), G87 (≠ A89), A139 (≠ T141), K165 (= K167), K167 (= K169), D196 (= D198), N198 (= N200), E222 (= E224), D247 (= D249), E248 (= E250), S249 (= S251), A269 (= A271), K271 (= K273), T272 (≠ I274), A298 (≠ G300), T299 (= T301), S300 (≠ M302), T324 (= T326), E325 (= E327), L326 (= L328)
- binding magnesium ion: D196 (= D198), E222 (= E224), D247 (= D249)
2p8cA Crystal structure of n-succinyl arg/lys racemase from bacillus cereus atcc 14579 complexed with n-succinyl arg. (see paper)
29% identity, 97% coverage: 6:367/373 of query aligns to 3:358/369 of 2p8cA
- active site: F19 (≠ H22), A50 (≠ T53), H53 (≠ G56), V136 (≠ T141), F160 (= F166), K161 (= K167), M162 (≠ L168), K163 (= K169), D191 (= D198), N193 (= N200), E218 (= E224), D243 (= D249), E244 (= E250), G245 (≠ S251), N265 (≠ A271), K267 (= K273), G294 (= G300), S295 (≠ T301), M296 (= M302), V319 (≠ T326), E320 (= E327), L321 (= L328)
- binding magnesium ion: D191 (= D198), E218 (= E224), D243 (= D249)
- binding n~2~-(3-carboxypropanoyl)-l-arginine: F19 (≠ H22), Y26 (≠ M29), M29 (≠ Q32), D51 (≠ I54), K163 (= K169), D191 (= D198), D243 (= D249), K267 (= K273), S295 (≠ T301), M296 (= M302), E320 (= E327), L321 (= L328), T322 (≠ F329)
2p8bA Crystal structure of n-succinyl arg/lys racemase from bacillus cereus atcc 14579 complexed with n-succinyl lys. (see paper)
29% identity, 97% coverage: 6:367/373 of query aligns to 3:358/369 of 2p8bA
- active site: F19 (≠ H22), A50 (≠ T53), H53 (≠ G56), V136 (≠ T141), F160 (= F166), K161 (= K167), M162 (≠ L168), K163 (= K169), D191 (= D198), N193 (= N200), E218 (= E224), D243 (= D249), E244 (= E250), G245 (≠ S251), N265 (≠ A271), K267 (= K273), G294 (= G300), S295 (≠ T301), M296 (= M302), V319 (≠ T326), E320 (= E327), L321 (= L328)
- binding magnesium ion: D191 (= D198), E218 (= E224), D243 (= D249)
- binding n-succinyl lysine: F19 (≠ H22), Y26 (≠ M29), D51 (≠ I54), V136 (≠ T141), K161 (= K167), K163 (= K169), D243 (= D249), K267 (= K273), S295 (≠ T301), M296 (= M302), E320 (= E327), L321 (= L328), T322 (≠ F329)
2p88A Crystal structure of n-succinyl arg/lys racemase from bacillus cereus atcc 14579 (see paper)
29% identity, 97% coverage: 6:367/373 of query aligns to 3:358/369 of 2p88A
- active site: F19 (≠ H22), A50 (≠ T53), H53 (≠ G56), V136 (≠ T141), F160 (= F166), K161 (= K167), M162 (≠ L168), K163 (= K169), D191 (= D198), N193 (= N200), E218 (= E224), D243 (= D249), E244 (= E250), G245 (≠ S251), N265 (≠ A271), K267 (= K273), G294 (= G300), S295 (≠ T301), M296 (= M302), V319 (≠ T326), E320 (= E327), L321 (= L328)
- binding magnesium ion: D191 (= D198), E218 (= E224), D243 (= D249)
Q81IL5 N-succinyl-L-Arg/Lys racemase; N-succinyl amino acid racemase; NSAR; EC 5.1.1.- from Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) (see paper)
29% identity, 97% coverage: 6:367/373 of query aligns to 3:358/369 of Q81IL5
- D191 (= D198) binding
- E218 (= E224) binding
- D243 (= D249) binding
O34508 L-Ala-D/L-Glu epimerase; AE epimerase; AEE; EC 5.1.1.20 from Bacillus subtilis (strain 168) (see 2 papers)
29% identity, 94% coverage: 9:360/373 of query aligns to 6:354/366 of O34508
- R24 (≠ H27) binding
- T135 (= T141) binding
- K160 (= K167) binding
- K162 (= K169) active site, Proton acceptor; specific for (R)-substrate epimerization
- D191 (= D198) binding
- E219 (= E224) binding
- D244 (= D249) binding
- K268 (= K273) active site, Proton acceptor; specific for (S)-substrate epimerization
- S296 (≠ T301) binding
- I298 (≠ L303) binding
- D321 (≠ E327) binding
- D323 (≠ F329) binding
1tkkA The structure of a substrate-liganded complex of the l-ala-d/l-glu epimerase from bacillus subtilis (see paper)
29% identity, 94% coverage: 9:360/373 of query aligns to 6:354/359 of 1tkkA
- active site: F19 (≠ H22), P50 (≠ T53), V53 (≠ A58), T135 (= T141), K160 (= K167), K162 (= K169), L190 (≠ V197), D191 (= D198), A192 (≠ V199), N193 (= N200), E219 (= E224), D244 (= D249), E245 (= E250), S246 (= S251), N266 (≠ A271), K268 (= K273), G295 (= G300), S296 (≠ T301), M297 (= M302), F320 (≠ T326), D321 (≠ E327), F322 (≠ L328)
- binding alanine: K160 (= K167), K162 (= K169), D321 (≠ E327), D323 (≠ F329)
- binding glutamic acid: F19 (≠ H22), R24 (≠ H27), K160 (= K167), D191 (= D198), K268 (= K273), S296 (≠ T301), M297 (= M302), I298 (≠ L303)
- binding magnesium ion: D191 (= D198), E219 (= E224), D244 (= D249)
1jpmA L-ala-d/l-glu epimerase (see paper)
29% identity, 94% coverage: 9:360/373 of query aligns to 6:354/359 of 1jpmA
- active site: F19 (≠ H22), P50 (≠ T53), V53 (≠ A58), T135 (= T141), K160 (= K167), K162 (= K169), L190 (≠ V197), D191 (= D198), A192 (≠ V199), N193 (= N200), E219 (= E224), D244 (= D249), E245 (= E250), S246 (= S251), N266 (≠ A271), K268 (= K273), G295 (= G300), S296 (≠ T301), M297 (= M302), F320 (≠ T326), D321 (≠ E327), F322 (≠ L328)
- binding magnesium ion: D191 (= D198), E219 (= E224), D244 (= D249)
3my9A Crystal structure of a muconate cycloisomerase from azorhizobium caulinodans
30% identity, 97% coverage: 5:367/373 of query aligns to 5:350/357 of 3my9A
- active site: P44 (≠ T53), W45 (≠ I54), S124 (≠ T141), K149 (= K167), K151 (= K169), D180 (= D198), N182 (= N200), E206 (= E224), D231 (= D249), E232 (= E250), S233 (= S251), S253 (≠ A271), K255 (= K273), G282 (= G300), T283 (= T301), L284 (≠ M302), C308 (≠ T326), E309 (= E327), F310 (≠ L328)
- binding magnesium ion: E206 (= E224), A221 (≠ N239), L224 (≠ S242), D231 (= D249)
3i6tB Crystal structure of muconate cycloisomerase from jannaschia sp.
31% identity, 91% coverage: 34:371/373 of query aligns to 32:363/364 of 3i6tB
- active site: S136 (≠ T141), K161 (= K167), K163 (= K169), D191 (= D198), N193 (= N200), E217 (= E224), D242 (= D249), E243 (= E250), S262 (≠ A271), K264 (= K273), G291 (= G300), D292 (≠ T301), M293 (= M302), C317 (≠ T326), E318 (= E327), F319 (≠ L328)
- binding magnesium ion: D191 (= D198), E217 (= E224), D242 (= D249)
Sites not aligning to the query:
3i6eA Crystal structure of muconate lactonizing enzyme from ruegeria pomeroyi.
32% identity, 91% coverage: 34:371/373 of query aligns to 20:353/356 of 3i6eA
- active site: S124 (≠ T141), K149 (= K167), K151 (= K169), D179 (= D198), Y180 (≠ V199), N181 (= N200), Q182 (= Q201), E205 (= E224), D230 (= D249), E231 (= E250), S232 (= S251), K254 (= K273), Y279 (= Y298), G281 (= G300), D282 (≠ T301), M283 (= M302), C307 (≠ T326), E308 (= E327), F309 (≠ L328)
- binding magnesium ion: D179 (= D198), E205 (= E224), D230 (= D249)
3dg6A Crystal structure of muconate lactonizing enzyme from mucobacterium smegmatis complexed with muconolactone (see paper)
29% identity, 98% coverage: 6:370/373 of query aligns to 3:363/366 of 3dg6A
- active site: L19 (≠ H22), P50 (≠ T53), R51 (≠ G55), M134 (≠ T141), K160 (= K167), K162 (= K169), D191 (= D198), N193 (= N200), E217 (= E224), D242 (= D249), E243 (= E250), S244 (= S251), K266 (= K273), G292 (= G300), N293 (≠ T301), Q294 (≠ M302), G319 (≠ T326), E320 (= E327), L321 (= L328)
- binding magnesium ion: D191 (= D198), E217 (= E224), D242 (= D249)
- binding [(2S)-5-oxo-2,5-dihydrofuran-2-yl]acetic acid: F21 (≠ L24), T54 (≠ A58), M134 (≠ T141), K160 (= K167), K162 (= K169), D191 (= D198), N193 (= N200), D242 (= D249), K266 (= K273), N293 (≠ T301), Q294 (≠ M302), I295 (≠ L303)
3q4dA Crystal structure of dipeptide epimerase from cytophaga hutchinsonii complexed with mg and dipeptide d-ala-l-ala (see paper)
27% identity, 93% coverage: 21:368/373 of query aligns to 18:360/368 of 3q4dA
- active site: F19 (≠ H22), P50 (≠ T53), T53 (≠ A58), T135 (= T141), K160 (= K167), K162 (= K169), D190 (= D198), N192 (= N200), E216 (= E224), D241 (= D249), E242 (= E250), S243 (= S251), K265 (= K273), G292 (= G300), G293 (≠ T301), F294 (≠ M302), Y317 (≠ T326), D318 (≠ E327), F319 (≠ L328)
- binding alanine: K162 (= K169), K265 (= K273), G293 (≠ T301)
- binding d-alanine: F19 (≠ H22), K162 (= K169), G293 (≠ T301), D318 (≠ E327), D320 (≠ F329), T321 (≠ G330)
- binding magnesium ion: D190 (= D198), E216 (= E224), D241 (= D249)
3q45A Crystal structure of dipeptide epimerase from cytophaga hutchinsonii complexed with mg and dipeptide d-ala-l-val (see paper)
27% identity, 93% coverage: 21:368/373 of query aligns to 18:360/368 of 3q45A
- active site: F19 (≠ H22), P50 (≠ T53), T53 (≠ A58), T135 (= T141), K160 (= K167), K162 (= K169), D190 (= D198), N192 (= N200), E216 (= E224), D241 (= D249), E242 (= E250), S243 (= S251), K265 (= K273), G292 (= G300), G293 (≠ T301), F294 (≠ M302), Y317 (≠ T326), D318 (≠ E327), F319 (≠ L328)
- binding d-alanine: F19 (≠ H22), K162 (= K169), D318 (≠ E327), D320 (≠ F329), T321 (≠ G330)
- binding magnesium ion: D190 (= D198), E216 (= E224), D241 (= D249)
- binding valine: K160 (= K167), K162 (= K169), D190 (= D198), K265 (= K273), G293 (≠ T301), F294 (≠ M302)
Query Sequence
>GFF2642 FitnessBrowser__psRCH2:GFF2642
MSPILIESIQAIVVDLPTIRPHKLAMHTMQQQTLVVIRVKCSDGIEGIGESTTIGGLAYG
NESPESIKQNIDSHLGPLLVGQDAANINAAMLRLDKAAKGNTFAKSGLESALLDAQGKRL
ALPVSELLGGRVRDSLEVAWTLASGNTTKDIEEAEHMLDIRRHRIFKLKIGAGEVNADLK
HVIAIKQALGERASVRVDVNQAWDESVALRACRILGDNGIDLIEQPISRINRGGQVRLNQ
RSPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQIAEAAGIALYGG
TMLEGAIGTLASAHAFVTINKLTWATELFGPLLLTEEIVTEAPVYRDFQLEVPRTPGLGL
TLDEERLAFFARK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory