SitesBLAST
Comparing GFF2644 FitnessBrowser__psRCH2:GFF2644 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
35% identity, 98% coverage: 4:256/259 of query aligns to 2:247/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), Q15 (= Q17), G16 (= G18), I17 (= I19), D36 (= D38), V63 (≠ L64), N89 (= N90), A91 (vs. gap), S94 (≠ G93), I142 (≠ V141), S143 (= S142), S144 (= S143), Y157 (= Y154), K161 (= K158), P187 (= P184), H188 (≠ G185), I190 (≠ T187), I194 (= I194)
Q9LBG2 Levodione reductase; (6R)-2,2,6-trimethyl-1,4-cyclohexanedione reductase; EC 1.1.1.- from Leifsonia aquatica (Corynebacterium aquaticum) (see paper)
35% identity, 98% coverage: 4:256/259 of query aligns to 10:262/267 of Q9LBG2
- 17:42 (vs. 11:36, 46% identical) binding
- E103 (≠ T94) mutation E->A,D,N,Q: 26-fold increase in Km and a much lower enantiomeric excess of the reaction products.
1iy8A Crystal structure of levodione reductase (see paper)
35% identity, 98% coverage: 4:256/259 of query aligns to 1:253/258 of 1iy8A
- active site: G15 (= G18), S143 (= S143), Q153 (≠ R151), Y156 (= Y154), K160 (= K158)
- binding nicotinamide-adenine-dinucleotide: G11 (= G14), S14 (≠ Q17), G15 (= G18), L16 (≠ I19), D35 (= D38), V36 (≠ R39), A62 (= A62), D63 (= D63), V64 (≠ L64), N90 (= N90), G92 (= G92), I93 (≠ G93), T141 (≠ V141), S143 (= S143), Y156 (= Y154), K160 (= K158), P186 (= P184), G187 (= G185), T191 (≠ A189), P192 (= P190), M193 (≠ I194)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
33% identity, 98% coverage: 4:256/259 of query aligns to 4:241/244 of 4nbuB
- active site: G18 (= G18), N111 (≠ S115), S139 (= S143), Q149 (≠ R151), Y152 (= Y154), K156 (= K158)
- binding acetoacetyl-coenzyme a: D93 (vs. gap), K98 (≠ A97), S139 (= S143), N146 (≠ S148), V147 (≠ L149), Q149 (≠ R151), Y152 (= Y154), F184 (≠ G186), M189 (≠ P190), K200 (≠ Q215)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), N17 (≠ Q17), G18 (= G18), I19 (= I19), D38 (= D38), F39 (≠ R39), V59 (≠ A62), D60 (= D63), V61 (≠ L64), N87 (= N90), A88 (≠ V91), G89 (= G92), I90 (≠ G93), T137 (≠ V141), S139 (= S143), Y152 (= Y154), K156 (= K158), P182 (= P184), F184 (≠ G186), T185 (= T187), T187 (vs. gap), M189 (≠ P190)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
36% identity, 97% coverage: 5:256/259 of query aligns to 3:244/247 of 4jroC
- active site: G16 (= G18), S142 (= S143), Q152 (≠ R151), Y155 (= Y154), K159 (= K158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (≠ A16), R15 (≠ Q17), G16 (= G18), I17 (= I19), N35 (≠ V37), Y36 (vs. gap), N37 (vs. gap), G38 (≠ D38), S39 (≠ R39), N63 (≠ D63), V64 (≠ L64), N90 (= N90), A91 (≠ V91), I93 (≠ G93), I113 (≠ R114), S142 (= S143), Y155 (= Y154), K159 (= K158), P185 (= P184), I188 (≠ T187), T190 (≠ A189)
6qheA Alcohol dehydrogenase from arthrobacter sp. Ts-15 in complex with NAD+
32% identity, 97% coverage: 4:255/259 of query aligns to 4:252/261 of 6qheA
- binding nicotinamide-adenine-dinucleotide: G14 (= G14), M17 (≠ Q17), G18 (= G18), M19 (≠ I19), D38 (= D38), R39 (= R39), D63 (= D63), I64 (≠ L64), A90 (≠ N90), A91 (≠ V91), S142 (= S143), Y156 (= Y154), K160 (= K158), P186 (= P184), G187 (= G185), M189 (≠ T187), T191 (≠ A189), P192 (= P190), M193 (≠ P191)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
34% identity, 97% coverage: 5:256/259 of query aligns to 3:242/248 of Q9KJF1
- S15 (≠ Q17) binding
- D36 (= D38) binding
- D62 (= D63) binding
- I63 (≠ L64) binding
- N89 (= N90) binding
- Y153 (= Y154) binding
- K157 (= K158) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
34% identity, 97% coverage: 5:256/259 of query aligns to 2:241/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G14), M16 (≠ I19), D35 (= D38), I36 (vs. gap), I62 (≠ L64), N88 (= N90), G90 (= G93), I138 (≠ V141), S140 (= S143), Y152 (= Y154), K156 (= K158), I185 (≠ T187)
1zemA Crystal structure of NAD+-bound xylitol dehydrogenase (see paper)
32% identity, 98% coverage: 3:256/259 of query aligns to 1:260/260 of 1zemA
- active site: N16 (≠ G18), S142 (= S143), Y155 (= Y154), K159 (= K158), D212 (≠ W208)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), G15 (≠ Q17), N16 (≠ G18), I17 (= I19), D36 (= D38), M37 (≠ R39), D62 (= D63), V63 (≠ L64), N89 (= N90), A90 (≠ V91), G91 (= G92), T140 (≠ V141), S142 (= S143), Y155 (= Y154), K159 (= K158), P185 (= P184), M188 (≠ E188)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
32% identity, 96% coverage: 8:256/259 of query aligns to 5:243/246 of 3osuA
2cfcA Structural basis for stereo selectivity in the (r)- and (s)-hydroxypropylethane thiosulfonate dehydrogenases (see paper)
33% identity, 96% coverage: 7:255/259 of query aligns to 2:245/250 of 2cfcA
- active site: G13 (= G18), S142 (= S143), Y155 (= Y154), K159 (= K158)
- binding (2-[2-ketopropylthio]ethanesulfonate: F149 (vs. gap), R152 (= R151), Y155 (= Y154), W195 (≠ E205), R196 (≠ K206)
- binding nicotinamide-adenine-dinucleotide: G9 (= G14), S12 (≠ Q17), G13 (= G18), N14 (≠ I19), D33 (= D38), L34 (≠ R39), A59 (= A62), D60 (= D63), V61 (≠ L64), N87 (= N90), A88 (≠ V91), G89 (= G92), I140 (≠ V141), P185 (= P184), G186 (= G185), M187 (≠ G186), I188 (≠ T187), T190 (≠ A189), P191 (= P190), M192 (≠ S202), T193 (≠ E203)
Q56840 2-(R)-hydroxypropyl-CoM dehydrogenase; R-HPCDH; 2-[(R)-2-hydroxypropylthio]ethanesulfonate dehydrogenase; Aliphatic epoxide carboxylation component III; Epoxide carboxylase component III; RHPCDH1; EC 1.1.1.268 from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 4 papers)
33% identity, 96% coverage: 7:255/259 of query aligns to 2:245/250 of Q56840
- SGN 12:14 (≠ QGI 17:19) binding
- D33 (= D38) binding
- DV 60:61 (≠ DL 63:64) binding
- N87 (= N90) binding
- S142 (= S143) mutation to A: Retains weak activity. 120-fold decrease in kcat.; mutation to C: Loss of activity.
- R152 (= R151) binding ; mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- Y155 (= Y154) mutation Y->E,F: Loss of activity.
- K159 (= K158) mutation to A: Loss of activity.
- R179 (= R178) mutation to A: Loss of activity.
- IETP-----------M 188:192 (≠ TEAPPRRIPRNAAEQS 187:202) binding
- WR 195:196 (≠ EK 205:206) binding
- R196 (≠ K206) mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- R203 (≠ V213) mutation to A: Slight decrease in catalytic efficiency.
- R209 (≠ S219) mutation to A: Does not affect catalytic efficiency.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
32% identity, 96% coverage: 8:256/259 of query aligns to 2:236/239 of 3sj7A
- active site: G12 (= G18), S138 (= S143), Q148 (≠ R151), Y151 (= Y154), K155 (= K158)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G14), S10 (≠ A16), R11 (≠ Q17), I13 (= I19), N31 (vs. gap), Y32 (vs. gap), A33 (≠ V37), G34 (≠ D38), S35 (≠ R39), A58 (= A62), N59 (≠ D63), V60 (≠ L64), N86 (= N90), A87 (≠ V91), T109 (≠ R114), S138 (= S143), Y151 (= Y154), K155 (= K158), P181 (= P184), G182 (= G185)
5jlaD Crystal structure of ribose-5-phosphate isomerase from brucella melitensis 16m
34% identity, 98% coverage: 5:258/259 of query aligns to 5:245/259 of 5jlaD
- active site: G18 (= G18), S139 (= S143), L148 (≠ R151), Y151 (= Y154), K155 (= K158), H196 (≠ Y209)
- binding nicotinamide-adenine-dinucleotide: G14 (= G14), S17 (≠ Q17), G18 (= G18), I19 (= I19), D38 (= D38), R39 (= R39), L58 (≠ A62), D59 (= D63), V60 (≠ L64), C86 (≠ N90), A87 (≠ V91), I137 (≠ V141), S139 (= S143), Y151 (= Y154), K155 (= K158), P181 (= P184), G182 (= G185), F183 (≠ G186), T184 (= T187), T186 (≠ A189), A188 (≠ Q201)
G9FRD7 7alpha-hydroxysteroid dehydrogenase; 7alpha-HSDH; NADP-dependent 7alpha-hydroxysteroid dehydrogenase; EC 1.1.1.- from Clostridium sardiniense (Clostridium absonum) (see 2 papers)
33% identity, 98% coverage: 3:256/259 of query aligns to 2:248/262 of G9FRD7
- SSTRGI 13:18 (≠ GAAQGI 14:19) binding
- R38 (= R39) binding ; mutation to D: Loss of catalytic activity.
- NA 63:64 (≠ AD 62:63) binding
- N90 (= N90) binding
- T145 (≠ S143) binding
- Y158 (= Y154) binding ; binding
- K162 (= K158) binding
- IGTRA 191:195 (≠ -GTEA 186:189) binding
Sites not aligning to the query:
- 261:262 mutation Missing: 5-fold reduction in catalytic efficiency.
5epoA The three-dimensional structure of clostridium absonum 7alpha- hydroxysteroid dehydrogenase (see paper)
33% identity, 98% coverage: 3:256/259 of query aligns to 1:247/261 of 5epoA
- active site: G16 (= G18), T144 (≠ S143), I152 (≠ L149), Y157 (= Y154), K161 (= K158), R193 (≠ E188)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S12 (≠ G14), T14 (≠ A16), R15 (≠ Q17), G16 (= G18), I17 (= I19), R37 (= R39), F61 (≠ T61), N62 (≠ A62), N89 (= N90), Y90 (≠ V91), G91 (= G92), Y157 (= Y154), K161 (= K158), P187 (= P184), G188 (= G185), I190 (vs. gap), T192 (= T187), R193 (≠ E188), A194 (= A189), A195 (≠ P190)
- binding taurochenodeoxycholic acid: T93 (= T94), T144 (≠ S143), G146 (≠ A145), R154 (= R151), Y157 (= Y154), G188 (= G185), N198 (≠ Q211), M199 (≠ I212), F203 (≠ T216)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
35% identity, 97% coverage: 5:256/259 of query aligns to 3:240/244 of 6t77A
- active site: G16 (= G18), S138 (= S143), Y151 (= Y154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (≠ A16), R15 (≠ Q17), T37 (≠ R39), L58 (≠ T59), N59 (≠ M60), V60 (≠ T61), A87 (≠ V91), G88 (= G92), I89 (≠ G93)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
30% identity, 97% coverage: 5:256/259 of query aligns to 4:248/252 of 1vl8B
- active site: G17 (= G18), S143 (= S143), I154 (≠ R151), Y157 (= Y154), K161 (= K158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), R16 (≠ Q17), G17 (= G18), L18 (≠ I19), S37 (≠ D38), R38 (= R39), C63 (≠ A62), D64 (= D63), V65 (≠ L64), A91 (≠ V91), A92 (≠ G92), G93 (= G93), I94 (≠ T94), V114 (≠ R114), I141 (≠ V141), S143 (= S143), Y157 (= Y154), K161 (= K158), P187 (= P184), G188 (= G185), Y190 (≠ T187), T192 (≠ I194), M194 (≠ R196), T195 (≠ N197)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
33% identity, 99% coverage: 1:256/259 of query aligns to 4:249/258 of 4wecA
- active site: G21 (= G18), S143 (= S143), Q154 (≠ R151), Y157 (= Y154), K161 (= K158)
- binding nicotinamide-adenine-dinucleotide: G17 (= G14), A19 (= A16), S20 (≠ Q17), G21 (= G18), I22 (= I19), D41 (= D38), I42 (≠ R39), V61 (≠ A62), D62 (= D63), V63 (≠ L64), N89 (= N90), T141 (≠ V141), Y157 (= Y154), K161 (= K158), P187 (= P184), P189 (≠ G186), V190 (≠ T187)
6jhbB Crystal structure of NADPH and 4-hydroxyphenylpyruvic acid bound aerf from microcystis aeruginosa (see paper)
31% identity, 99% coverage: 1:256/259 of query aligns to 1:260/264 of 6jhbB
- active site: G18 (= G18), S160 (≠ K158)
- binding 3-(4-hydroxy-phenyl)pyruvic acid: G147 (≠ A145), S149 (≠ R147), L157 (≠ G155), S160 (≠ K158), N164 (= N162)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G14 (= G14), S16 (≠ A16), A17 (≠ Q17), G18 (= G18), I19 (= I19), G38 (≠ D38), R39 (= R39), N40 (≠ S40), A65 (= A62), D66 (= D63), V67 (≠ L64), H68 (≠ E65), N93 (= N90), S94 (≠ V91), E95 (≠ G92), K119 (≠ S115), I145 (≠ V141), I146 (= I144), P190 (= P184), I193 (≠ T187), T195 (≠ A189), P196 (= P190), R197 (≠ P191)
Query Sequence
>GFF2644 FitnessBrowser__psRCH2:GFF2644
MNKRFQNKVAVITGAAQGIGRRVAERMGEEGGRLLLVDRSELVHELADELGAKGVEVLTM
TADLEQFADCHSVMDAAKARFGRVDILVNNVGGTIWAKPFEHYQEHEIEAEVRRSLFPTL
WCCHAALPHMLEQGAGAIVNVSSIATRSLNRVPYGAAKGGVNALTACLAFENAQRGVRVN
ATAPGGTEAPPRRIPRNAAEQSEQEKIWYQQIVDQTVDSSLMKRYGTIDEQAGAILFLAS
DDASYITGVTLPVGGGDLG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory