Comparing GFF2646 FitnessBrowser__Phaeo:GFF2646 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
38% identity, 86% coverage: 15:239/261 of query aligns to 22:247/265 of P07821
5x40A Structure of a cbio dimer bound with amppcp (see paper)
37% identity, 80% coverage: 23:230/261 of query aligns to 21:230/280 of 5x40A
Sites not aligning to the query:
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
28% identity, 83% coverage: 22:237/261 of query aligns to 17:233/240 of 6mjpA
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
31% identity, 79% coverage: 23:227/261 of query aligns to 22:216/353 of 1vciA
Sites not aligning to the query:
Q9LVM1 ABC transporter B family member 25, mitochondrial; ABC transporter ABCB.25; AtABCB25; ABC transporter of the mitochondrion 3; AtATM3; Iron-sulfur clusters transporter ATM3; Protein STARIK 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 83% coverage: 12:228/261 of query aligns to 487:700/728 of Q9LVM1
4f4cA The crystal structure of the multi-drug transporter (see paper)
34% identity, 83% coverage: 15:230/261 of query aligns to 1031:1249/1250 of 4f4cA
Sites not aligning to the query:
7n5aA Structure of atatm3 in the closed conformation (see paper)
33% identity, 83% coverage: 12:228/261 of query aligns to 360:573/589 of 7n5aA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
32% identity, 85% coverage: 22:242/261 of query aligns to 17:238/241 of 4u00A
Sites not aligning to the query:
7n59A Structure of atatm3 in the inward-facing conformation with gssg bound (see paper)
33% identity, 83% coverage: 12:228/261 of query aligns to 361:574/590 of 7n59A
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 83% coverage: 23:238/261 of query aligns to 21:230/343 of P30750
Sites not aligning to the query:
O06967 Multidrug resistance ABC transporter ATP-binding/permease protein BmrA; EC 7.6.2.- from Bacillus subtilis (strain 168) (see 2 papers)
30% identity, 87% coverage: 11:237/261 of query aligns to 346:573/589 of O06967
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
30% identity, 83% coverage: 23:238/261 of query aligns to 22:231/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
30% identity, 83% coverage: 23:238/261 of query aligns to 22:231/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
30% identity, 83% coverage: 23:238/261 of query aligns to 22:231/344 of 3tuiC
Sites not aligning to the query:
8i6rB Cryo-em structure of pseudomonas aeruginosa ftse(e163q)x/envc complex with atp in peptidisc (see paper)
31% identity, 76% coverage: 23:220/261 of query aligns to 18:217/222 of 8i6rB
Sites not aligning to the query:
4mrvA Structure of a bacterial atm1-family abc transporter (see paper)
31% identity, 87% coverage: 5:231/261 of query aligns to 353:579/600 of 4mrvA
Sites not aligning to the query:
4mrsA Structure of a bacterial atm1-family abc transporter (see paper)
31% identity, 87% coverage: 5:231/261 of query aligns to 353:579/600 of 4mrsA
Sites not aligning to the query:
4mrpA Structure of a bacterial atm1-family abc transporter (see paper)
31% identity, 87% coverage: 5:231/261 of query aligns to 353:579/600 of 4mrpA
Sites not aligning to the query:
4mrnA Structure of a bacterial atm1-family abc transporter (see paper)
31% identity, 87% coverage: 5:231/261 of query aligns to 353:579/600 of 4mrnA
6parA Structure of a bacterial atm1-family abc exporter with mgamppnp bound (see paper)
31% identity, 87% coverage: 5:231/261 of query aligns to 339:565/578 of 6parA
>GFF2646 FitnessBrowser__Phaeo:GFF2646
MTAASLTVTDVSWGPGRAAPLILHPISFHLDAGRVLGVVGPNGAGKSSLLRVIYRFNQPR
SGKVEVGDSDIWALPPKAAAQRVAAVLQEQPTDFALTVAEIVALGRAPYRSGFATPGARD
AAIIEGMLDRLDLYSMADRAFGTLSGGERQRVMVARALAQEPSLLVLDEPTNHLDIRHQL
DVLDLIRDLDVTIVTSLHDLNIAAGACDEILLMSEGRQLAFGTPHDVLSEDTVSRVFNVA
ARRETLTPSGQDHLTFHLPVS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory