SitesBLAST
Comparing GFF2647 FitnessBrowser__psRCH2:GFF2647 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O85673 Anthranilate 1,2-dioxygenase large subunit; EC 1.14.12.1 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see 2 papers)
50% identity, 94% coverage: 19:443/453 of query aligns to 24:453/471 of O85673
- M43 (= M38) mutation to K: Prevents anthranilate degradation.
- D217 (= D214) mutation to A: In ACN476; loss of dioxygenase activity and 2-fold lower redox potential.; mutation to E: Loss of dioxygenase activity and lack of iron at the mononuclear site.; mutation to N: Loss of dioxygenase activity.
8h2tB Cryo-em structure of iadd/e dioxygenase bound with iaa (see paper)
29% identity, 85% coverage: 6:392/453 of query aligns to 7:398/435 of 8h2tB
- binding fe (iii) ion: N208 (= N211), H214 (= H217), H219 (= H222), D375 (= D369)
- binding fe2/s2 (inorganic) cluster: C83 (= C88), H85 (= H90), K86 (≠ R91), C104 (= C108), H107 (= H111), W109 (= W113)
- binding 1h-indol-3-ylacetic acid: N208 (= N211), L209 (≠ G212), D211 (= D214), H214 (= H217), P215 (≠ V218), F249 (vs. gap), K320 (≠ M313), Y360 (vs. gap)
7ylsB Structure of a bacteria protein complex
29% identity, 85% coverage: 6:392/453 of query aligns to 8:399/436 of 7ylsB
2xrxA Crystal structure of biphenyl dioxygenase in complex with biphenyl from burkholderia xenovorans lb400 (see paper)
30% identity, 81% coverage: 15:382/453 of query aligns to 12:374/432 of 2xrxA
- active site: H106 (= H111), D203 (= D214), H206 (= H217), H212 (= H222), D361 (= D369)
- binding biphenyl: Q199 (≠ N211), F200 (vs. gap), D203 (= D214), H206 (= H217), H296 (≠ N303), L306 (≠ M313), F309 (= F316), F357 (≠ A365)
- binding fe (ii) ion: Q199 (≠ N211), H206 (= H217), H212 (= H222), D361 (= D369)
- binding fe2/s2 (inorganic) cluster: C83 (= C88), H85 (= H90), R86 (= R91), C103 (= C108), Y105 (≠ F110), H106 (= H111), W108 (= W113)
2yflA Crystal structure of biphenyl dioxygenase variant rr41 with 2-chloro dibenzofuran (see paper)
29% identity, 81% coverage: 15:382/453 of query aligns to 12:375/433 of 2yflA
- active site: H106 (= H111), D204 (= D214), H207 (= H217), H213 (= H222), D362 (= D369)
- binding 2-chlorodibenzofuran: Q200 (≠ N211), D204 (= D214), M205 (≠ G215), H207 (= H217), S257 (≠ H263), H297 (≠ N303), L307 (≠ M313), F352 (= F359)
- binding fe (ii) ion: Q200 (≠ N211), H207 (= H217), H213 (= H222), D362 (= D369)
- binding fe2/s2 (inorganic) cluster: C83 (= C88), H85 (= H90), R86 (= R91), C103 (= C108), Y105 (≠ F110), H106 (= H111), W108 (= W113)
2yfjA Crystal structure of biphenyl dioxygenase variant rr41 with dibenzofuran (see paper)
29% identity, 81% coverage: 15:382/453 of query aligns to 12:375/433 of 2yfjA
- active site: H106 (= H111), D204 (= D214), H207 (= H217), H213 (= H222), D362 (= D369)
- binding dibenzofuran: Q200 (≠ N211), F201 (vs. gap), D204 (= D214), M205 (≠ G215), H207 (= H217), A208 (≠ V218), H297 (≠ N303), L307 (≠ M313), F358 (≠ A365)
- binding fe (ii) ion: Q200 (≠ N211), H207 (= H217), H213 (= H222), D362 (= D369)
- binding fe2/s2 (inorganic) cluster: C83 (= C88), H85 (= H90), R86 (= R91), C103 (= C108), Y105 (≠ F110), H106 (= H111), W108 (= W113)
2xshA Crystal structure of p4 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 in complex with 2,6 di chlorobiphenyl (see paper)
29% identity, 81% coverage: 15:382/453 of query aligns to 12:375/433 of 2xshA
- active site: H106 (= H111), D204 (= D214), H207 (= H217), H213 (= H222), D362 (= D369)
- binding 2,6-dichlorobiphenyl: F201 (vs. gap), M205 (≠ G215), H207 (= H217), Q296 (≠ R302), H297 (≠ N303), L307 (≠ M313), F358 (≠ A365)
- binding fe (ii) ion: Q200 (≠ N211), H207 (= H217), H213 (= H222), D362 (= D369)
- binding fe2/s2 (inorganic) cluster: C83 (= C88), H85 (= H90), R86 (= R91), C103 (= C108), Y105 (≠ F110), H106 (= H111), W108 (= W113)
2gbxA Crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1 bound to biphenyl (see paper)
31% identity, 78% coverage: 24:376/453 of query aligns to 11:362/449 of 2gbxA
- active site: H98 (= H111), D199 (= D214), H202 (= H217), H207 (≠ Y225), D355 (= D369)
- binding biphenyl: D199 (= D214), V203 (= V218), L255 (= L266), H288 (= H300), N290 (= N303), L300 (≠ M313)
- binding fe (iii) ion: H202 (= H217), H207 (≠ Y225), D355 (= D369)
- binding fe2/s2 (inorganic) cluster: C75 (= C88), H77 (= H90), R78 (= R91), C95 (= C108), Y97 (≠ F110), H98 (= H111), W100 (= W113)
2gbwA Crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1 (see paper)
31% identity, 78% coverage: 24:376/453 of query aligns to 11:362/449 of 2gbwA
- active site: H98 (= H111), D199 (= D214), H202 (= H217), H207 (≠ Y225), D355 (= D369)
- binding fe (iii) ion: H202 (= H217), H207 (≠ Y225), D355 (= D369)
- binding fe2/s2 (inorganic) cluster: C75 (= C88), H77 (= H90), R78 (= R91), C95 (= C108), Y97 (≠ F110), H98 (= H111), W100 (= W113)
- binding oxygen molecule: H202 (= H217), F345 (= F359), D355 (= D369)
5aeuA Crystal structure of ii9 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 (see paper)
28% identity, 81% coverage: 15:382/453 of query aligns to 12:375/433 of 5aeuA
- active site: H106 (= H111), D204 (= D214), H207 (= H217), H213 (= H222), D362 (= D369)
- binding fe (ii) ion: H207 (= H217), H213 (= H222), D362 (= D369)
- binding fe2/s2 (inorganic) cluster: C83 (= C88), H85 (= H90), R86 (= R91), M88 (≠ A93), C103 (= C108), Y105 (≠ F110), H106 (= H111), W108 (= W113)
4hm8A Naphthalene 1,2-dioxygenase bound to thioanisole
31% identity, 79% coverage: 24:383/453 of query aligns to 17:379/446 of 4hm8A
- active site: H104 (= H111), D205 (= D214), H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding (methylsulfanyl)benzene: N201 (= N211), H295 (= H300)
- binding fe (iii) ion: H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding fe2/s2 (inorganic) cluster: C81 (= C88), H83 (= H90), R84 (= R91), C101 (= C108), Y103 (≠ F110), H104 (= H111), W106 (= W113)
4hm7A Naphthalene 1,2-dioxygenase bound to styrene
31% identity, 79% coverage: 24:383/453 of query aligns to 17:379/446 of 4hm7A
- active site: H104 (= H111), D205 (= D214), H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding fe (iii) ion: H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding fe2/s2 (inorganic) cluster: C81 (= C88), H83 (= H90), R84 (= R91), C101 (= C108), Y103 (≠ F110), H104 (= H111), W106 (= W113)
- binding ethenylbenzene: N201 (= N211), H208 (= H217), H295 (= H300), N297 (= N303)
4hm6A Naphthalene 1,2-dioxygenase bound to phenetole
31% identity, 79% coverage: 24:383/453 of query aligns to 17:379/446 of 4hm6A
- active site: H104 (= H111), D205 (= D214), H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding ethoxybenzene: N201 (= N211), H208 (= H217), H295 (= H300)
- binding fe (iii) ion: H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding fe2/s2 (inorganic) cluster: C81 (= C88), H83 (= H90), R84 (= R91), C101 (= C108), Y103 (≠ F110), H104 (= H111), W106 (= W113)
4hm4A Naphthalene 1,2-dioxygenase bound to indan
31% identity, 79% coverage: 24:383/453 of query aligns to 17:379/446 of 4hm4A
- active site: H104 (= H111), D205 (= D214), H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding 2,3-dihydro-1H-indene: H208 (= H217), H295 (= H300), N297 (= N303)
- binding fe (iii) ion: H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding fe2/s2 (inorganic) cluster: C81 (= C88), H83 (= H90), R84 (= R91), C101 (= C108), Y103 (≠ F110), H104 (= H111), W106 (= W113)
4hm3A Naphthalene 1,2-dioxygenase bound to ethylbenzene
31% identity, 79% coverage: 24:383/453 of query aligns to 17:379/446 of 4hm3A
- active site: H104 (= H111), D205 (= D214), H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding fe (iii) ion: H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding fe2/s2 (inorganic) cluster: C81 (= C88), H83 (= H90), R84 (= R91), C101 (= C108), Y103 (≠ F110), H104 (= H111), W106 (= W113)
- binding phenylethane: N201 (= N211), D205 (= D214), H208 (= H217), N297 (= N303)
4hm2A Naphthalene 1,2-dioxygenase bound to ethylphenylsulfide
31% identity, 79% coverage: 24:383/453 of query aligns to 17:379/446 of 4hm2A
- active site: H104 (= H111), D205 (= D214), H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding (ethylsulfanyl)benzene: N201 (= N211), D205 (= D214), V209 (= V218), H295 (= H300), N297 (= N303)
- binding fe (iii) ion: H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding fe2/s2 (inorganic) cluster: C81 (= C88), H83 (= H90), R84 (= R91), C101 (= C108), Y103 (≠ F110), H104 (= H111), W106 (= W113)
4hm1A Naphthalene 1,2-dioxygenase bound to 1-indanone
31% identity, 79% coverage: 24:383/453 of query aligns to 17:379/446 of 4hm1A
- active site: H104 (= H111), D205 (= D214), H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding 2,3-dihydro-1H-inden-1-one: N201 (= N211), V209 (= V218), N297 (= N303)
- binding fe (iii) ion: H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding fe2/s2 (inorganic) cluster: C81 (= C88), H83 (= H90), R84 (= R91), C101 (= C108), Y103 (≠ F110), H104 (= H111), W106 (= W113)
4hkvA Naphthalene 1,2-dioxygenase bound to benzamide
31% identity, 79% coverage: 24:383/453 of query aligns to 17:379/446 of 4hkvA
- active site: H104 (= H111), D205 (= D214), H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding fe (iii) ion: H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding fe2/s2 (inorganic) cluster: C81 (= C88), H83 (= H90), R84 (= R91), C101 (= C108), Y103 (≠ F110), H104 (= H111), W106 (= W113)
- binding benzamide: N201 (= N211), H208 (= H217), H295 (= H300), N297 (= N303)
4hjlA Naphthalene 1,2-dioxygenase bound to 1-chloronaphthalene
31% identity, 79% coverage: 24:383/453 of query aligns to 17:379/446 of 4hjlA
- active site: H104 (= H111), D205 (= D214), H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding 1-chloronaphthalene: N201 (= N211), D205 (= D214), H208 (= H217), H295 (= H300), N297 (= N303), L307 (≠ M313)
- binding fe (iii) ion: H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding fe2/s2 (inorganic) cluster: C81 (= C88), H83 (= H90), R84 (= R91), C101 (= C108), Y103 (≠ F110), H104 (= H111), W106 (= W113)
2hmoA Crystal structure of naphthalene 1,2-dioxygenase bound to 3- nitrotoluene. (see paper)
31% identity, 79% coverage: 24:383/453 of query aligns to 17:379/446 of 2hmoA
- active site: H104 (= H111), D205 (= D214), H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding 3-nitrotoluene: N201 (= N211), N297 (= N303), W358 (≠ A365)
- binding fe (iii) ion: H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding fe2/s2 (inorganic) cluster: C81 (= C88), H83 (= H90), R84 (= R91), C101 (= C108), Y103 (≠ F110), H104 (= H111), W106 (= W113)
Query Sequence
>GFF2647 FitnessBrowser__psRCH2:GFF2647
MSLGIDYLDSLLEEDKEKGIFRCKREIFTAPELFELEMKHIFEGNWIYLAHESQIPEKND
YYTTTMGRQPIFIARNKDGVLNAFINACSHRGATLCRYKRGNKATYTCPFHGWTFNNSGK
LLKVKDPKEAGYPESFDCDGSHDLKKVARFESYRGFLFGSLNPDVSSLEDFLGESRKIID
MIVDQSPEGLEVLRGSSTYVFDGNWKLQAENGADGYHVTAVHWNYAATQQQRKLKDAGDD
IRAMSAGGWGKKGGGFYSFENGHMLLWTRWDNPEDRPLFSQRDRLVEEFGEARADWMIGH
SRNLCLYPNLYLMDQFGSQLRIARPISVDKTEVTIYCIAPKGESAEARARRIRQYEDFFN
VSGMATPDDLEEFRACQEGFQGRSLQWNDMSRGAAHWIEGADESAQQIDLHPLLSGVRTE
DEGLYVVQHGYWRDQMVKAVKKEQDQLIHVEGA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory