Comparing GFF2657 FitnessBrowser__WCS417:GFF2657 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
61% identity, 38% coverage: 409:660/664 of query aligns to 3:255/258 of P02915
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
62% identity, 37% coverage: 413:660/664 of query aligns to 3:251/258 of 1b0uA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
53% identity, 37% coverage: 412:658/664 of query aligns to 1:236/240 of 4ymuJ
3c4jA Abc protein artp in complex with atp-gamma-s
53% identity, 38% coverage: 411:659/664 of query aligns to 2:239/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
53% identity, 38% coverage: 411:659/664 of query aligns to 2:239/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
53% identity, 38% coverage: 411:659/664 of query aligns to 2:239/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
53% identity, 38% coverage: 411:659/664 of query aligns to 2:239/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
55% identity, 37% coverage: 412:659/664 of query aligns to 2:237/241 of 4u00A
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
37% identity, 56% coverage: 20:388/664 of query aligns to 19:384/385 of Q56232
Sites not aligning to the query:
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
37% identity, 55% coverage: 20:384/664 of query aligns to 19:380/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
37% identity, 55% coverage: 20:384/664 of query aligns to 19:380/382 of 1bjwA
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
37% identity, 55% coverage: 20:384/664 of query aligns to 19:380/382 of 1b5oA
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
37% identity, 55% coverage: 20:384/664 of query aligns to 19:380/382 of 1gc4A
1gc3A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan (see paper)
37% identity, 55% coverage: 20:384/664 of query aligns to 19:380/382 of 1gc3A
Sites not aligning to the query:
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
35% identity, 54% coverage: 25:382/664 of query aligns to 18:378/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
35% identity, 54% coverage: 25:382/664 of query aligns to 18:378/388 of 1gd9A
1j32A Aspartate aminotransferase from phormidium lapideum
32% identity, 58% coverage: 1:386/664 of query aligns to 1:384/388 of 1j32A
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
34% identity, 54% coverage: 29:386/664 of query aligns to 34:382/384 of 1o4sB
Q02635 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.79 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
32% identity, 55% coverage: 20:387/664 of query aligns to 19:397/400 of Q02635
Sites not aligning to the query:
6f77A Crystal structure of the prephenate aminotransferase from rhizobium meliloti (see paper)
32% identity, 55% coverage: 20:387/664 of query aligns to 18:396/399 of 6f77A
>GFF2657 FitnessBrowser__WCS417:GFF2657
MRFSPFVERIAGQGVAAWDIHHAAFQAASQGEDIIILSVGDPDFATPSFITDAAVSALRE
GDTHYTEIPGRPALREAIAARYSKTLARALSAENVITVAGAQNALFVTSLCLLQAGDEVL
VLDPMYVTYEATLKASGATLVRVPCSPESGFRLDAQLLGAAITPRTRAIFFSNPNNPTGV
VLNLQELQAIADLAIARDLWVVVDEVYESLVFDGEYHSLAALPGMAERCVVIGSLSKSHA
MTGWRIGWIIATPQMVAHAETLVLSMLYGLPGFVMEAATAAVLAHDDVTQGMREIYRRRR
DLVMAGLSACPGIKVQAPQAGMFVLVDVRGTGLGSLDFAWRLFREAGVSVLDAAAFGAPA
QGFVRLSFTLGEERLSEACQRIAHFVAKLAGEPRIAAAPRIEEVPAAEAKKMIEVIDLHK
RFGNIEVLKGISLTAHEGDVISLIGASGSGKSTLLRCINMLEVPDQGSIHVDGESIKLNY
GRPGAPLVADARQLVRIRSTLGMVFQNFNLWPHRTVLENLIEAPTQVLRESRAEAIERAE
ALLERVGLAAKRNEYPAFLSGGQQQRVAIARALAMRPKVMLFDEPTSALDPELVGEVLRV
IRSLAEEGRTMILVTHEMAFARDVSSKVAFLHQGMIEETGSPDAVFIDPRSERCRQFVNA
HQTR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory