Comparing GFF2658 FitnessBrowser__WCS417:GFF2658 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5orgA Structure of the periplasmic binding protein (pbp) occj from a. Tumefaciens b6 in complex with octopine. (see paper)
36% identity, 82% coverage: 26:258/284 of query aligns to 3:256/257 of 5orgA
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
37% identity, 84% coverage: 18:256/284 of query aligns to 16:257/260 of P02911
5owfA Structure of a lao-binding protein mutant with glutamine (see paper)
38% identity, 77% coverage: 38:256/284 of query aligns to 11:232/235 of 5owfA
1lstA Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand (see paper)
38% identity, 77% coverage: 38:256/284 of query aligns to 14:235/238 of 1lstA
1lahE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
38% identity, 77% coverage: 38:256/284 of query aligns to 14:235/238 of 1lahE
1lagE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
38% identity, 77% coverage: 38:256/284 of query aligns to 14:235/238 of 1lagE
1lafE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
38% identity, 77% coverage: 38:256/284 of query aligns to 14:235/238 of 1lafE
Sites not aligning to the query:
1hslA Refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors (see paper)
35% identity, 81% coverage: 28:256/284 of query aligns to 3:235/238 of 1hslA
P02910 Histidine-binding periplasmic protein; HBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
35% identity, 81% coverage: 28:256/284 of query aligns to 25:257/260 of P02910
Sites not aligning to the query:
P0AEU0 Histidine-binding periplasmic protein; HBP from Escherichia coli (strain K12) (see 3 papers)
35% identity, 81% coverage: 28:256/284 of query aligns to 25:257/260 of P0AEU0
Sites not aligning to the query:
5otcA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with noroctopinic acid. (see paper)
34% identity, 78% coverage: 38:258/284 of query aligns to 12:254/256 of 5otcA
Sites not aligning to the query:
5otaA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with octopinic acid (see paper)
34% identity, 78% coverage: 38:258/284 of query aligns to 12:254/254 of 5otaA
Sites not aligning to the query:
5ot9A Structure of the periplasmic binding protein (pbp) noct from a.Tumefaciens c58 in complex with histopine. (see paper)
34% identity, 78% coverage: 38:258/284 of query aligns to 12:254/254 of 5ot9A
Sites not aligning to the query:
4powA Structure of the pbp noct in complex with pyronopaline (see paper)
34% identity, 78% coverage: 38:258/284 of query aligns to 12:254/254 of 4powA
Sites not aligning to the query:
5itoA Structure of the periplasmic binding protein m117n-noct from a. Tumefaciens in complex with octopine (see paper)
34% identity, 78% coverage: 38:258/284 of query aligns to 13:255/255 of 5itoA
Sites not aligning to the query:
5ovzA High resolution structure of the pbp noct in complex with nopaline (see paper)
34% identity, 78% coverage: 38:258/284 of query aligns to 13:255/259 of 5ovzA
Sites not aligning to the query:
3tqlA Structure of the amino acid abc transporter, periplasmic amino acid- binding protein from coxiella burnetii. (see paper)
34% identity, 79% coverage: 29:252/284 of query aligns to 4:225/225 of 3tqlA
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
31% identity, 76% coverage: 38:253/284 of query aligns to 14:224/225 of 4zv2A
Sites not aligning to the query:
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
31% identity, 76% coverage: 38:253/284 of query aligns to 14:226/226 of 4zv1A
Sites not aligning to the query:
8hqrA Crystal structure of the arginine-/lysine-binding protein sar11_1210 from 'candidatus pelagibacter ubique' htcc1062 bound to arginine
32% identity, 77% coverage: 38:257/284 of query aligns to 18:266/267 of 8hqrA
Sites not aligning to the query:
>GFF2658 FitnessBrowser__WCS417:GFF2658
MKSKRMATWLGSAVLMLAAGFSWAAEKPIVFAVAAEPYPPFTVKGGNGQWSGFEVDLIHK
LCEGMKAECQIKEVAWDGIIPSLLAKKIDVIFSSMSVTDEREKQIAFSRAYYDSLLGVAG
PKGSEVEISPAGLKGKLIGVQISTVSANYLKKYYENIADLKYYDTQESANADLIAGRIDY
MMADDTAIAMMVKTPEASGLAHIASVPYDPIIGRGVGAGLRKEDTALKARLDKAIGELLV
SKDYDDLSQHYFGLSVSPCKRTDTPAFVSKTCDSPYPQIAQKTE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory