SitesBLAST
Comparing GFF2664 FitnessBrowser__Marino:GFF2664 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P13703 Hydroxymethylglutaryl-CoA lyase; HL; HMG-CoA lyase; 3-hydroxy-3-methylglutarate-CoA lyase; EC 4.1.3.4 from Pseudomonas mevalonii (see paper)
46% identity, 86% coverage: 3:265/307 of query aligns to 4:266/301 of P13703
- C237 (= C236) active site
P35914 Hydroxymethylglutaryl-CoA lyase, mitochondrial; HL; HMG-CoA lyase; 3-hydroxy-3-methylglutarate-CoA lyase; EC 4.1.3.4 from Homo sapiens (Human) (see 11 papers)
40% identity, 86% coverage: 2:265/307 of query aligns to 32:295/325 of P35914
- E37 (≠ D7) to K: in HMGCLD; activity lower than 5% respect to the wild-type; mutation to D: Normal activity.
- R41 (= R11) to Q: in HMGCLD; loss of activity and of proton exchange; dbSNP:rs121964997; mutation to M: Reduced activity, and loss of proton exchange.
- D42 (= D12) to E: in HMGCLD; reduced activity; to G: in HMGCLD; loss of activity; dbSNP:rs1467902610; to H: in HMGCLD; loss of activity; mutation D->A,N: Loss of activity, and reduced proton exchange rate.
- K48 (≠ G18) to N: in HMGCLD; abolishes almost all enzymatic activity
- E72 (= E42) mutation to A: Loss of activity, and reduced affinity for metal cofactor and substrate.
- S142 (= S112) to F: in HMGCLD; activity lower than 5% respect to the wild-type
- C174 (= C144) to Y: in HMGCLD; activity lower than 5% respect to the wild-type; dbSNP:rs765475941
- F192 (≠ M162) to S: in HMGCLD; activity lower than 5% respect to the wild-type
- I200 (= I170) to F: in HMGCLD; activity lower than 5% respect to the wild-type
- G203 (≠ A173) to E: in HMGCLD; complete loss of activity; dbSNP:rs1553131940
- D204 (= D174) mutation to A: Reduced activity, and reduced affinity for metal cofactor and substrate.
- H233 (= H203) to R: in HMGCLD; loss of activity; dbSNP:rs727503963; mutation to A: Loss of activity, and reduced proton exchange rate.
- E279 (= E249) mutation to A: Reduced thermal stability, but normal activity.
- D280 (= D250) mutation to A: Normal activity.
Sites not aligning to the query:
- 323 modified: Interchain; C→S: Abolishes interchain homodimerization. Exhibits no DTT stimulated activity.
3mp3B Crystal structure of human lyase in complex with inhibitor hg-coa (see paper)
40% identity, 86% coverage: 2:265/307 of query aligns to 5:268/296 of 3mp3B
- binding (3R,5S,9R,21S)-1-[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-4-hydroxy-3-(phosphonooxy)tetrahydrofuran-2-yl]-3,5,9,21-tetrahydroxy-8,8-dimethyl-10,14,19-trioxo-2,4,6-trioxa-18-thia-11,15-diaza-3,5-diphosphatricosan-23-oic acid 3,5-dioxide: R14 (= R11), D15 (= D12), Q18 (= Q15), F49 (= F46), V50 (= V47), S51 (= S48), W54 (≠ A51), P81 (= P78), N82 (= N79), K84 (= K81), G85 (= G82), N111 (= N108), R122 (≠ V119), Y140 (= Y137), S142 (≠ A139), T178 (= T175), H206 (= H203)
- binding magnesium ion: D15 (= D12), H206 (= H203), H208 (= H205)
2cw6A Crystal structure of human hmg-coa lyase: insights into catalysis and the molecular basis for hydroxymethylglutaric aciduria (see paper)
40% identity, 86% coverage: 2:265/307 of query aligns to 5:268/296 of 2cw6A
3mp5B Crystal structure of human lyase r41m in complex with hmg-coa (see paper)
40% identity, 86% coverage: 2:265/307 of query aligns to 5:268/296 of 3mp5B
- binding 3-hydroxy-3-methylglutaryl-coenzyme a: D15 (= D12), Q18 (= Q15), S51 (= S48), W54 (≠ A51), F100 (≠ V97), N111 (= N108), N113 (≠ R110), Y140 (= Y137), S142 (≠ A139), T178 (= T175), C239 (= C236)
- binding magnesium ion: D15 (= D12), H206 (= H203), H208 (= H205)
Q8TB92 3-hydroxy-3-methylglutaryl-CoA lyase, cytoplasmic; 3-hydroxy-3-methylglutaryl-CoA lyase-like protein 1; HMGCL-like 1; Endoplasmic reticulum 3-hydroxy-3-methylglutaryl-CoA lyase; er-cHL; EC 4.1.3.4 from Homo sapiens (Human) (see 2 papers)
37% identity, 86% coverage: 3:265/307 of query aligns to 78:340/370 of Q8TB92
- R86 (= R11) mutation to Q: Abolishes catalytic activity.
- L237 (≠ M162) mutation to S: Abolishes catalytic activity.
- H278 (= H203) mutation to R: Abolishes catalytic activity.
Sites not aligning to the query:
- 2 modified: N-myristoyl glycine; G→A: Abolishes myristoylation and induces a subcellular location change.
6ndsA Structure of an hmg-coa lyase from acenitobacter baumannii in complex with coenzyme a and 3-methylmalate
39% identity, 90% coverage: 5:279/307 of query aligns to 10:280/305 of 6ndsA
- binding coenzyme a: V52 (= V47), S53 (= S48), I57 (≠ V52), N84 (= N79), G87 (= G82), R90 (≠ L85), N113 (= N108), M114 (≠ I109), R115 (= R110)
- binding zinc ion: D17 (= D12), H207 (= H203), H209 (= H205)
1ydnA Crystal structure of the hmg-coa lyase from brucella melitensis, northeast structural genomics target lr35. (see paper)
40% identity, 86% coverage: 3:265/307 of query aligns to 4:266/283 of 1ydnA
6ktqA Crystal structure of catalytic domain of homocitrate synthase from sulfolobus acidocaldarius (sahcs(dram)) in complex with alpha- ketoglutarate/zn2+/coa (see paper)
23% identity, 93% coverage: 1:284/307 of query aligns to 20:291/399 of 6ktqA
- binding 2-oxoglutaric acid: R30 (= R11), R154 (≠ Q135), T156 (≠ Y137), E158 (≠ A139), S184 (≠ I171), T188 (= T175), H216 (= H203), H218 (= H205)
- binding coenzyme a: V67 (≠ A51), R96 (≠ K81), A97 (≠ G82), F116 (≠ V97), H128 (≠ I109), E158 (≠ A139)
- binding zinc ion: E31 (≠ D12), H216 (= H203), H218 (= H205)
3ivtB Homocitrate synthase lys4 bound to 2-og (see paper)
26% identity, 73% coverage: 11:234/307 of query aligns to 38:250/400 of 3ivtB
Q9Y823 Homocitrate synthase, mitochondrial; HCS; EC 2.3.3.14 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see 2 papers)
26% identity, 73% coverage: 11:234/307 of query aligns to 43:255/418 of Q9Y823
- R43 (= R11) binding ; mutation R->A,K,Q: Abolishes the catalytic activity.
- E44 (≠ D12) binding ; binding ; binding
- Q47 (= Q15) mutation to A: Abolishes the catalytic activity.
- E74 (= E42) mutation to A: Abolishes the catalytic activity.; mutation to Q: Results in a moderate decrease in the turnover number and a slight increase in the Km value for each substrate.
- H103 (≠ G75) binding ; mutation to A: Substantially impairs catalytic efficiency.
- D123 (≠ N95) binding ; mutation to N: Does not affect the catalytic activity but impairs L-lysine inhibition.
- R163 (≠ Q135) binding ; mutation R->A,Q: Abolishes the catalytic activity.; mutation to K: Severely diminishes affinity for 2-oxoglutarate and substantially impairs catalytic efficiency.
- S165 (≠ Y137) binding ; mutation to A: Results in a moderate decrease in catalytic efficiency.
- E167 (≠ A139) mutation E->A,Q: Abolishes the catalytic activity.
- T197 (= T175) binding ; binding ; mutation to A: Exhibits a 25-fold decrease in catalytic efficiency.; mutation to S: Results in a modest decrease in catalytic efficiency.; mutation to V: Abolishes the catalytic activity.
- E222 (≠ S201) mutation to Q: Does not affect the catalytic activity but impairs L-lysine inhibition.
- H224 (= H203) binding ; binding
- H226 (= H205) binding ; binding
Sites not aligning to the query:
- 288 R→K: Does not affect the catalytic activity but impairs L-lysine inhibition.
- 332 Y→A: Abolishes the catalytic activity.; Y→F: Results in a decrease in catalytic efficiency.
- 364 Q→R: Does not affect the catalytic activity but impairs L-lysine inhibition.
3rmjB Crystal structure of truncated alpha-isopropylmalate synthase from neisseria meningitidis (see paper)
24% identity, 92% coverage: 2:284/307 of query aligns to 3:280/308 of 3rmjB
Q9JZG1 2-isopropylmalate synthase; Alpha-IPM synthase; Alpha-isopropylmalate synthase; EC 2.3.3.13 from Neisseria meningitidis serogroup B (strain MC58) (see 2 papers)
26% identity, 92% coverage: 2:284/307 of query aligns to 6:283/517 of Q9JZG1
- D16 (= D12) binding
- H204 (= H203) binding
- H206 (= H205) binding
- N240 (= N245) binding
Sites not aligning to the query:
- 366:517 Required for the condensation reaction. Not required to bind substrate
3ivsA Homocitrate synthase lys4 (see paper)
28% identity, 73% coverage: 11:234/307 of query aligns to 20:219/364 of 3ivsA
4jn6C Crystal structure of the aldolase-dehydrogenase complex from mycobacterium tuberculosis hrv37 (see paper)
25% identity, 87% coverage: 3:269/307 of query aligns to 4:255/339 of 4jn6C
- active site: D13 (= D12), H16 (≠ Q15), H195 (= H203), H197 (= H205)
- binding manganese (ii) ion: D13 (= D12), H195 (= H203), H197 (= H205)
- binding oxalate ion: R12 (= R11), M136 (vs. gap), V164 (≠ A173), S166 (≠ T175), H195 (= H203), H197 (= H205)
Sites not aligning to the query:
3mi3A Homocitrate synthase lys4 bound to lysine (see paper)
28% identity, 73% coverage: 11:234/307 of query aligns to 20:221/370 of 3mi3A
P9WMK5 4-hydroxy-2-oxohexanoate aldolase; 4-hydroxy-2-keto-pentanoic acid aldolase; 4-hydroxy-2-oxopentanoate aldolase; 4-hydroxy-2-oxovalerate aldolase; HOA; EC 4.1.3.43; EC 4.1.3.39 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
25% identity, 87% coverage: 3:269/307 of query aligns to 7:258/346 of P9WMK5
- D16 (= D12) binding
- H198 (= H203) binding
- H200 (= H205) binding
Sites not aligning to the query:
- 322 G→F: Abolishes substrate channeling to HsaG.
3bliA Crystal structure of the catalytic domain of licms in complexed with pyruvate and acetyl-coa (see paper)
20% identity, 91% coverage: 2:281/307 of query aligns to 1:274/311 of 3bliA
Q8F3Q1 (R)-citramalate synthase CimA; LiCMS; EC 2.3.3.21 from Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) (see 2 papers)
20% identity, 91% coverage: 2:281/307 of query aligns to 7:280/516 of Q8F3Q1
- R16 (= R11) mutation R->K,Q: Loss of activity.
- RD 16:17 (= RD 11:12) binding
- D17 (= D12) mutation to A: 34-fold increase in Km for pyruvate and 315-fold decrease in kcat.; mutation to N: 4.4-fold increase in Km for pyruvate and 480-fold decrease in kcat.
- L81 (≠ A74) mutation to A: 4.7-fold increase in Km for pyruvate and 15.7-fold decrease in kcat.; mutation to V: 3.3-fold increase in Km for pyruvate and 10.1-fold decrease in kcat.
- F83 (≠ L76) mutation to A: 5-fold increase in Km for acetyl-CoA and 120-fold decrease in kcat.
- L104 (≠ V97) mutation to V: 1.8-fold increase in Km for pyruvate and 3.4-fold decrease in kcat.
- Y144 (= Y137) binding ; mutation to L: 259-fold increase in Km for pyruvate and 76-fold decrease in kcat.; mutation to V: 114-fold increase in Km for pyruvate and 5.3-fold decrease in kcat.
- E146 (≠ A139) mutation E->D,Q: Minor effects on the binding of acetyl-CoA, but causes a strong decrease in kcat.
- T179 (= T175) binding ; mutation to A: 16.4-fold increase in Km for pyruvate and 186-fold decrease in kcat.
Sites not aligning to the query:
- 302 mutation H->A,N: Loss of activity.
- 304 D→A: 5.2-fold increase in Km for acetyl-CoA and 16.6-fold decrease in kcat.
- 310 N→A: 2.2-fold increase in Km for acetyl-CoA and 1.7-fold decrease in kcat.
- 311 L→A: 8-fold increase in Km for acetyl-CoA and 6-fold decrease in kcat.
- 312 Y→A: Loss of activity.
- 430 Y→L: No change in Km for acetyl-CoA and 2.3-fold decrease in kcat. Severely impairs inhibition by isoleucine.
- 431 D→A: 1.8-fold decrease in Km for acetyl-CoA and 5-fold decrease in kcat.
- 451 L→V: 1.5-fold increase in Km for acetyl-CoA and 4.3 decrease in kcat.
- 454 Y→A: 1.4 decrease in Km for acetyl-CoA and 17-fold decrease in kcat. Still inhibited by isoleucine and weakly inhibited by leucine.
- 458 I→A: 1.3-fold decrease in Km for acetyl-CoA and 14-fold decrease in kcat. Abolishes inhibition by isoleucine.
- 464 T→A: 1.8-fold decrease in Km for acetyl-CoA and 4.3-fold decrease in kcat.
- 468 V→A: No change in Km for acetyl-CoA and 2-fold decrease in kcat. Increases inhibition by isoleucine and leucine becomes an effective inhibitor.
- 493 P→A: 1.5-fold decrease in Km for acetyl-CoA and 2.6-fold decrease in kcat.
- 495 Q→A: 1.6-fold decrease in Km for acetyl-CoA and 2.8-fold decrease in kcat.
Q53WI0 4-hydroxy-2-oxovalerate aldolase; HOA; 4-hydroxy-2-keto-pentanoic acid aldolase; 4-hydroxy-2-oxohexanoate aldolase; 4-hydroxy-2-oxopentanoate aldolase; EC 4.1.3.39; EC 4.1.3.43 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
23% identity, 88% coverage: 5:275/307 of query aligns to 13:275/347 of Q53WI0
Sites not aligning to the query:
- 324 A→G: Increases the channeling efficiency of propanaldehyde from 57% to 94%.
Query Sequence
>GFF2664 FitnessBrowser__Marino:GFF2664
MKVRVNDVGPRDGLQSQGKTLSVDARAQLIEALVGAGLRNIEAGSFVSPKAVPQMAGTDE
LFSRLPASDKVRYAGLVPNMKGYQLATAAGAKVVNVVLSVTDTMNQKNIRMSLDETADVC
KAIVERGHLEGVEVQAYLAVAFECPFEGLVDPEVVARYARLMHSAGAAKIIIADTIGAAN
PTQVRQVLDLVVPEVGADRLSCHFHDTRGMALANITVAVDRGVCEFDSSIGGLGGCPFSP
GATGNVATEDVVLLLNSMGHDTGIDPLDLVPLVHLAEELTGVPLGGKSFRWLSQQRAKLL
GEAGHVG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory