Comparing GFF2675 FitnessBrowser__WCS417:GFF2675 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
37% identity, 89% coverage: 26:300/310 of query aligns to 1:273/274 of 2ioyA
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
35% identity, 92% coverage: 22:306/310 of query aligns to 6:284/284 of 7e7mC
A0QYB5 D-threitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
34% identity, 84% coverage: 40:300/310 of query aligns to 47:307/349 of A0QYB5
Sites not aligning to the query:
4rsmA Crystal structure of carbohydrate transporter msmeg_3599 from mycobacterium smegmatis str. Mc2 155, target efi-510970, in complex with d-threitol (see paper)
34% identity, 84% coverage: 40:300/310 of query aligns to 15:275/315 of 4rsmA
Sites not aligning to the query:
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
29% identity, 91% coverage: 28:309/310 of query aligns to 4:292/292 of 2fn8A
4rs3A Crystal structure of carbohydrate transporter a0qyb3 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with xylitol (see paper)
35% identity, 65% coverage: 57:258/310 of query aligns to 30:234/315 of 4rs3A
Sites not aligning to the query:
A0QYB3 Xylitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
35% identity, 65% coverage: 57:258/310 of query aligns to 63:267/349 of A0QYB3
Sites not aligning to the query:
5hkoA Crystal structure of abc transporter solute binding protein msmeg_3598 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with l-sorbitol
35% identity, 65% coverage: 57:258/310 of query aligns to 30:234/314 of 5hkoA
Sites not aligning to the query:
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
32% identity, 81% coverage: 28:278/310 of query aligns to 4:252/271 of 1dbpA
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
33% identity, 70% coverage: 28:243/310 of query aligns to 5:229/287 of 5dteB
Sites not aligning to the query:
5ibqA Crystal structure of an abc solute binding protein from rhizobium etli cfn 42 (rhe_pf00037,target efi-511357) in complex with alpha-d-apiose
30% identity, 85% coverage: 37:301/310 of query aligns to 14:279/287 of 5ibqA
4ry0A Crystal structure of ribose transporter solute binding protein rhe_pf00037 from rhizobium etli cfn 42, target efi-511357, in complex with d-ribose
30% identity, 85% coverage: 37:301/310 of query aligns to 14:279/287 of 4ry0A
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
29% identity, 85% coverage: 30:294/310 of query aligns to 2:267/313 of 2h3hA
3c6qC Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
29% identity, 85% coverage: 30:294/310 of query aligns to 2:267/305 of 3c6qC
2x7xA Fructose binding periplasmic domain of hybrid two component system bt1754 (see paper)
31% identity, 78% coverage: 58:299/310 of query aligns to 32:275/301 of 2x7xA
Sites not aligning to the query:
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
30% identity, 82% coverage: 26:278/310 of query aligns to 3:252/270 of 4zjpA
4yo7A Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi- 511484) with bound myo-inositol
26% identity, 90% coverage: 26:304/310 of query aligns to 7:284/287 of 4yo7A
4ry9B Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
26% identity, 89% coverage: 28:303/310 of query aligns to 5:290/297 of 4ry9B
4ry9A Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
26% identity, 89% coverage: 28:303/310 of query aligns to 5:290/297 of 4ry9A
5hqjA Crystal structure of abc transporter solute binding protein b1g1h7 from burkholderia graminis c4d1m, target efi-511179, in complex with d-arabinose
30% identity, 76% coverage: 70:304/310 of query aligns to 49:288/289 of 5hqjA
Sites not aligning to the query:
>GFF2675 FitnessBrowser__WCS417:GFF2675
MNLKRMFPVIALAALMSQAVEARELKALGISMGSLGNPYFVTLADGATARAKELNPNVKV
TSVSADYDLSKQFSQIDNFISSKVDLILINAVDPSAMASAIKKARDAGIVVVAVDVDAKG
VNATVQTDNVEAGKLACQYLVDKLSGKGNVIIQNGPQVTAVTDRVKGCKAALAAAPDIKV
LSDDQDGKGSREGGLNVMQGYLTRFPKIDGLFAINDPQAVGSDLAAKQLKRSGLIITSVD
GAPDIENALKTDSQIQASSSQDPWAMAQTAVNVGNDILNDKAPAEAVTLLTPKLITRDNI
GTYSGWSSKH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory