Comparing GFF2677 FitnessBrowser__WCS417:GFF2677 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09099 Xylulose kinase; XK; Xylulokinase; 1-deoxy-D-xylulokinase; EC 2.7.1.17; EC 2.7.1.- from Escherichia coli (strain K12) (see paper)
45% identity, 95% coverage: 7:478/496 of query aligns to 3:480/484 of P09099
2itmA Crystal structure of the e. Coli xylulose kinase complexed with xylulose (see paper)
43% identity, 95% coverage: 7:478/496 of query aligns to 3:472/476 of 2itmA
3ll3B The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
29% identity, 94% coverage: 7:474/496 of query aligns to 5:475/490 of 3ll3B
3ll3A The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
29% identity, 94% coverage: 7:474/496 of query aligns to 6:477/492 of 3ll3A
3kzbA Crystal structure of xylulokinase from chromobacterium violaceum
30% identity, 86% coverage: 9:435/496 of query aligns to 9:446/498 of 3kzbA
3i8bA The crystal structure of xylulose kinase from bifidobacterium adolescentis
28% identity, 86% coverage: 8:434/496 of query aligns to 8:466/506 of 3i8bA
6k76A Glycerol kinase form thermococcus kodakarensis, complex structure with substrate.
23% identity, 96% coverage: 7:482/496 of query aligns to 2:475/485 of 6k76A
3ge1A 2.7 angstrom crystal structure of glycerol kinase (glpk) from staphylococcus aureus in complex with adp and glycerol
22% identity, 96% coverage: 7:483/496 of query aligns to 7:492/499 of 3ge1A
Q5HGD2 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Staphylococcus aureus (strain COL)
22% identity, 96% coverage: 7:483/496 of query aligns to 6:491/498 of Q5HGD2
3l0qA The crystal structure of xlylulose kinase from yersinia pseudotuberculosis
23% identity, 95% coverage: 7:477/496 of query aligns to 5:529/541 of 3l0qA
1bu6Y Crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation (see paper)
21% identity, 91% coverage: 7:459/496 of query aligns to 6:471/499 of 1bu6Y
O34154 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus faecalis (strain ATCC 700802 / V583) (see 2 papers)
22% identity, 97% coverage: 7:486/496 of query aligns to 8:495/501 of O34154
Sites not aligning to the query:
1glfO Crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation (see paper)
21% identity, 91% coverage: 7:459/496 of query aligns to 6:471/498 of 1glfO
1bo5O Crystal structure of the complex between escherichia coli glycerol kinase and the allosteric regulator fructose 1,6-bisphosphate. (see paper)
21% identity, 91% coverage: 7:459/496 of query aligns to 6:471/498 of 1bo5O
P18157 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Bacillus subtilis (strain 168) (see paper)
21% identity, 96% coverage: 7:483/496 of query aligns to 6:491/496 of P18157
P0A6F3 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Escherichia coli (strain K12) (see 10 papers)
21% identity, 91% coverage: 7:459/496 of query aligns to 8:473/502 of P0A6F3
Sites not aligning to the query:
O86033 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
22% identity, 82% coverage: 7:414/496 of query aligns to 6:426/497 of O86033
1gldG Cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation (see paper)
20% identity, 91% coverage: 7:459/496 of query aligns to 4:462/489 of 1gldG
1glcG Cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation (see paper)
20% identity, 91% coverage: 7:459/496 of query aligns to 4:462/489 of 1glcG
1glbG Structure of the regulatory complex of escherichia coli iiiglc with glycerol kinase (see paper)
20% identity, 91% coverage: 7:459/496 of query aligns to 4:462/489 of 1glbG
>GFF2677 FitnessBrowser__WCS417:GFF2677
MSNPVSLGIDLGTSELKAILMDLDGSVLAHAGVRLSVSRRNSGWSEQDPQDWWQACLQAL
AQLRTHEAFARVACIGLSGQMHGAVLLGADNRVLYPAILWDDSRAVAEAERLGTAFADVT
GSLPMAGLTAPKLLWLKQHEPQVFKAIDCVLSPKDYLRLRLSGERISEMSDAAGTLWLDV
ARREWFVPMLRATGLSPAQMPRLVEGGAASAVLTVDGLGLSSSVVIAGGGGDNPVAAVGI
GAIKAGDAFITLGTSAAIVAITDHAAGNPASAVHSFCHALPNRWYTMGAMLAGASCLRWV
TRLTGMPDEQTLLDQVQAQLPIKQAVPLSTPLFLPYLAGERTPHNDPLLRGGFMGLGHDC
TPAMLGYAVMEGVGFGLLDALRAVQSAGANVDACALVGGGARSEYWAQLLANILQREIYT
LHGSELSACIGAAKLGFLSIGEGDALLQAGMPVKARYRPDSAQQAVLAARYRLFQGLLGA
AKALHEQAMQPCQASR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory