SitesBLAST
Comparing GFF2680 FitnessBrowser__Marino:GFF2680 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6yu6B Crystal structure of mhst in complex with l-leucine (see paper)
45% identity, 95% coverage: 22:466/470 of query aligns to 2:438/446 of 6yu6B
6yu5A Crystal structure of mhst in complex with l-valine (see paper)
45% identity, 95% coverage: 22:466/470 of query aligns to 2:438/441 of 6yu5A
6yu3A Crystal structure of mhst in complex with l-phenylalanine (see paper)
45% identity, 95% coverage: 22:466/470 of query aligns to 2:438/441 of 6yu3A
6yu2A Crystal structure of mhst in complex with l-isoleucine (see paper)
45% identity, 95% coverage: 22:466/470 of query aligns to 2:438/441 of 6yu2A
4us3A Crystal structure of the bacterial nss member mhst in an occluded inward-facing state (see paper)
45% identity, 95% coverage: 22:466/470 of query aligns to 2:438/441 of 4us3A
- binding sodium ion: G17 (= G37), A19 (= A39), V20 (= V40), V20 (= V40), G21 (= G41), N24 (= N44), T224 (= T247), D256 (= D279), A313 (= A336), S316 (≠ T339), S317 (= S340)
- binding tryptophan: S18 (= S38), A19 (= A39), L22 (= L42), G23 (= G43), Y101 (= Y125), F223 (= F246), T224 (= T247), S226 (= S249), M229 (= M252), S320 (= S343), L321 (= L344)
6yu7A Crystal structure of mhst in complex with l-tyrosine (see paper)
45% identity, 95% coverage: 22:466/470 of query aligns to 2:438/442 of 6yu7A
6yu4A Crystal structure of mhst in complex with l-4f-phenylalanine (see paper)
45% identity, 95% coverage: 22:466/470 of query aligns to 2:438/442 of 6yu4A
- binding 4-fluoro-l-phenylalanine: S18 (= S38), A19 (= A39), G21 (= G41), L22 (= L42), G23 (= G43), Y101 (= Y125), F223 (= F246), T224 (= T247), S226 (= S249), M229 (= M252), L321 (= L344)
4us4A Crystal structure of the bacterial nss member mhst in an occluded inward-facing state (lipidic cubic phase form) (see paper)
45% identity, 93% coverage: 31:466/470 of query aligns to 2:429/433 of 4us4A
- binding (2s)-2,3-dihydroxypropyl(7z)-pentadec-7-enoate: A173 (≠ I206), T180 (= T213), I287 (≠ M319), R288 (≠ P320), L289 (≠ M321)
- binding sodium ion: G8 (= G37), S9 (= S38), A10 (= A39), V11 (= V40), V11 (= V40), N15 (= N44), T215 (= T247), D247 (= D279), A304 (= A336), S307 (≠ T339), S308 (= S340)
- binding tryptophan: S9 (= S38), A10 (= A39), G12 (= G41), G14 (= G43), Y92 (= Y125), F214 (= F246), T215 (= T247), S217 (= S249), M220 (= M252), L312 (= L344)
3gwwA Leucine transporter leut in complex with s-fluoxetine (see paper)
31% identity, 73% coverage: 22:365/470 of query aligns to 1:371/501 of 3gwwA
- binding leucine: A18 (= A39), G20 (= G41), G22 (= G43), Y104 (= Y125), F244 (= F246), T245 (= T247), S247 (= S249), F250 (≠ M252), I350 (≠ L344)
- binding (3S)-N-methyl-3-phenyl-3-[4-(trifluoromethyl)phenoxy]propan-1-amine: L21 (= L42), G22 (= G43), R26 (≠ K47), Y104 (= Y125), A310 (≠ G304), F311 (≠ P305)
Sites not aligning to the query:
2q6hA Crystal structure analysis of leut complexed with l-leucine, sodium, and clomipramine (see paper)
28% identity, 95% coverage: 21:466/470 of query aligns to 2:461/512 of 2q6hA
- binding 3-(3-chloro-5h-dibenzo[b,f]azepin-5-yl)-n,n-dimethylpropan-1-amine: R28 (≠ K47), Q32 (≠ V51), R189 (= R191), F190 (≠ A192), I193 (= I195), F316 (≠ P305), F346 (= F335), L396 (= L384), D397 (= D404)
- binding leucine: A20 (= A39), G22 (= G41), G24 (= G43), Y106 (= Y125), F249 (= F246), T250 (= T247), S252 (= S249), F255 (≠ M252)
- binding sodium ion: G18 (= G37), A20 (= A39), V21 (= V40), V21 (= V40), G22 (= G41), N25 (= N44), T250 (= T247), N282 (≠ D279), A347 (= A336), T350 (= T339), S351 (= S340)
2qeiA Crystal structure analysis of leut complexed with l-alanine, sodium, and clomipramine (see paper)
28% identity, 95% coverage: 21:466/470 of query aligns to 1:460/511 of 2qeiA
- binding alanine: A19 (= A39), G21 (= G41), G23 (= G43), Y105 (= Y125), F248 (= F246), T249 (= T247), S251 (= S249)
- binding 3-(3-chloro-5h-dibenzo[b,f]azepin-5-yl)-n,n-dimethylpropan-1-amine: R27 (≠ K47), V30 (≠ Y50), Q31 (≠ V51), Y104 (≠ F124), R180 (= R183), R188 (= R191), F189 (≠ A192), F315 (≠ P305), F345 (= F335), D396 (= D404), D399 (= D407)
- binding sodium ion: G17 (= G37), A19 (= A39), V20 (= V40), V20 (= V40), G21 (= G41), N24 (= N44), T249 (= T247), N281 (≠ D279), A346 (= A336), T349 (= T339), S350 (= S340)
2q72A Crystal structure analysis of leut complexed with l-leucine, sodium, and imipramine (see paper)
28% identity, 95% coverage: 21:466/470 of query aligns to 1:460/511 of 2q72A
- binding 3-(5h-dibenzo[b,f]azepin-5-yl)-n,n-dimethylpropan-1-amine: R27 (≠ K47), V30 (≠ Y50), Q31 (≠ V51), R188 (= R191), F189 (≠ A192), I192 (= I195), A314 (≠ G304), F315 (≠ P305), F345 (= F335), D396 (= D404)
- binding leucine: A19 (= A39), G21 (= G41), L22 (= L42), G23 (= G43), Y105 (= Y125), F248 (= F246), T249 (= T247), S251 (= S249), F254 (≠ M252)
- binding sodium ion: G17 (= G37), A19 (= A39), V20 (= V40), V20 (= V40), G21 (= G41), N24 (= N44), T249 (= T247), N281 (≠ D279), A346 (= A336), T349 (= T339), S350 (= S340)
3mpnA F177r1 mutant of leut (see paper)
28% identity, 95% coverage: 22:466/470 of query aligns to 1:459/505 of 3mpnA
- binding leucine: N17 (≠ S38), A18 (= A39), G20 (= G41), L21 (= L42), G22 (= G43), Y104 (= Y125), F247 (= F246), T248 (= T247), S250 (= S249), F253 (≠ M252), S349 (= S340)
- binding S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl] methanesulfonothioate: C171 (≠ V177), A377 (= A367)
3gwvA Leucine transporter leut in complex with r-fluoxetine (see paper)
28% identity, 95% coverage: 22:466/470 of query aligns to 1:459/498 of 3gwvA
- binding leucine: A18 (= A39), G20 (= G41), G22 (= G43), Y104 (= Y125), F247 (= F246), T248 (= T247), S250 (= S249), F253 (≠ M252)
- binding (3R)-N-methyl-3-phenyl-3-[4-(trifluoromethyl)phenoxy]propan-1-amine: L21 (= L42), R26 (≠ K47), A313 (≠ G304), F314 (≠ P305), L394 (= L384), D395 (= D404), D398 (= D407)
3f3aA Crystal structure of leut bound to l-tryptophan and sodium (see paper)
28% identity, 95% coverage: 22:466/470 of query aligns to 1:458/504 of 3f3aA
- binding sodium ion: G16 (= G37), N17 (≠ S38), A18 (= A39), V19 (= V40), V19 (= V40), G20 (= G41), N23 (= N44), T247 (= T247), N279 (≠ D279), A344 (= A336), T347 (= T339), S348 (= S340)
- binding tryptophan: R7 (= R28), A18 (= A39), G20 (= G41), L21 (= L42), G22 (= G43), R26 (≠ K47), Y104 (= Y125), G242 (= G242), F246 (= F246), F246 (= F246), T247 (= T247), S249 (= S249), F252 (≠ M252), D265 (≠ N265), Q266 (≠ I266), D267 (≠ S267), F299 (= F291), N303 (≠ F295), A306 (≠ G298), I307 (≠ L299), A310 (≠ G302), N314 (≠ G306), S348 (= S340), I352 (≠ L344), D397 (= D407), G401 (≠ A411), T402 (≠ N412), G432 (≠ S442)
2qb4A Crystal structure analysis of leut complexed with l-leucine, sodium and desipramine (see paper)
28% identity, 95% coverage: 22:466/470 of query aligns to 1:459/510 of 2qb4A
- binding 3-(10,11-dihydro-5h-dibenzo[b,f]azepin-5-yl)-n-methylpropan-1-amine: R26 (≠ K47), V29 (≠ Y50), Q30 (≠ V51), I107 (= I128), R187 (= R191), F188 (≠ A192), I191 (= I195), A313 (≠ G304), F314 (≠ P305), F344 (= F335), D395 (= D404)
- binding leucine: A18 (= A39), G20 (= G41), L21 (= L42), G22 (= G43), Y104 (= Y125), F247 (= F246), T248 (= T247), S250 (= S249), F253 (≠ M252)
- binding sodium ion: G16 (= G37), A18 (= A39), V19 (= V40), V19 (= V40), G20 (= G41), N23 (= N44), T248 (= T247), N280 (≠ D279), A345 (= A336), T348 (= T339), S349 (= S340)
3uslA Crystal structure of leut bound to l-selenomethionine in space group c2 from lipid bicelles (see paper)
31% identity, 73% coverage: 22:365/470 of query aligns to 1:373/502 of 3uslA
- binding selenomethionine: A18 (= A39), G20 (= G41), G22 (= G43), Y104 (= Y125), F246 (= F246), T247 (= T247), S249 (= S249), S348 (= S340), I352 (≠ L344)
- binding sodium ion: G16 (= G37), N17 (≠ S38), A18 (= A39), V19 (= V40), V19 (= V40), G20 (= G41), N23 (= N44), T247 (= T247), N279 (≠ D279), A344 (= A336), T347 (= T339), S348 (= S340)
- binding phosphocholine: N83 (≠ D101), R84 (= R102), F85 (≠ L103)
3usgA Crystal structure of leut bound to l-leucine in space group c2 from lipid bicelles (see paper)
31% identity, 73% coverage: 22:365/470 of query aligns to 1:373/502 of 3usgA
- binding leucine: A18 (= A39), G20 (= G41), G22 (= G43), F246 (= F246), T247 (= T247), S249 (= S249), F252 (≠ M252)
- binding sodium ion: G16 (= G37), N17 (≠ S38), A18 (= A39), V19 (= V40), V19 (= V40), G20 (= G41), N23 (= N44), T247 (= T247), N279 (≠ D279), A344 (= A336), T347 (= T339), S348 (= S340)
- binding phosphocholine: N83 (≠ D101), R84 (= R102)
3gwuA Leucine transporter leut in complex with sertraline (see paper)
28% identity, 95% coverage: 22:466/470 of query aligns to 1:459/509 of 3gwuA
- binding leucine: A18 (= A39), G20 (= G41), G22 (= G43), Y104 (= Y125), F247 (= F246), T248 (= T247), S250 (= S249), F253 (≠ M252)
- binding (1S,4S)-4-(3,4-dichlorophenyl)-N-methyl-1,2,3,4-tetrahydronaphthalen-1-amine: L25 (≠ W46), R26 (≠ K47), Y104 (= Y125), F247 (= F246), A313 (≠ G304), D395 (= D404), D398 (= D407)
3f4jA Crystal structure of leut bound to glycine and sodium (see paper)
28% identity, 95% coverage: 22:466/470 of query aligns to 1:459/509 of 3f4jA
- binding glycine: A18 (= A39), G20 (= G41), G22 (= G43), Y104 (= Y125), F247 (= F246), T248 (= T247), S250 (= S249)
- binding sodium ion: G16 (= G37), A18 (= A39), V19 (= V40), V19 (= V40), G20 (= G41), G22 (= G43), N23 (= N44), T248 (= T247), N280 (≠ D279), A345 (= A336), G346 (≠ A337), T348 (= T339), S349 (= S340)
Query Sequence
>GFF2680 FitnessBrowser__Marino:GFF2680
MSVTSSDSAAYSGALEGSNAQRGLWSSRLAFILAATGSAVGLGNIWKFPYVTGENGGGAF
VLVYLLCIAVVGIPIMMAEVMIGRRGGRSPVKSLSLIAEHDRLKPAWKLVGAIGILAGFL
ILSFYSVIGGWAISYVGTTASGQLAGQSADTVGAVFSGLLSDPTKLLAWHTLFMAMVMVV
VVRGVRSGLERAVSILMPALFVLLLIVVGYAMTTGHFGQAAAFLFQPDFSKLTTSGILVA
LGHAFFTLSLGMAVMMAYGSYLPKNISIAKTSITVSVIDTGVALLAGLAIFPIVFANGLE
PGAGPGLIFQTLPLAFGQMPMGSLFGTLFFVLLIFAAWTSGISLLEPIVEWLEERKGMNR
TVSTLGAGFVCWGLGIASILSLNLWSDFAPLGFVPMLEGKTIFDLLDFFTANIMLPLGGL
LVALFAGWVMSRQAMERELALSPAMFNLWLITVRFITPVAVAVVFIYNLM
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory