SitesBLAST
Comparing GFF2696 FitnessBrowser__WCS417:GFF2696 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6ihhA Crystal structure of rasadh f12 from ralstonia.Sp in complex with NADPH and a6o
53% identity, 100% coverage: 1:249/249 of query aligns to 1:249/249 of 6ihhA
- binding (2R,3S)-2-ethyl-2-[(2E)-2-(6-methoxy-3,4-dihydro-2H-naphthalen-1-ylidene)ethyl]-3-oxidanyl-cyclopentan-1-one: S137 (= S137), H147 (≠ F147), Y150 (= Y150), L188 (= L188), L246 (≠ F246)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), N15 (= N15), S16 (= S16), G17 (= G17), I18 (= I18), R38 (= R38), R39 (= R39), D60 (= D60), V61 (≠ I61), N87 (= N87), S88 (≠ A88), G89 (= G89), V110 (≠ I110), T135 (= T135), S137 (= S137), Y150 (= Y150), K154 (= K154), P180 (= P180), G181 (= G181), A182 (≠ P182), I183 (= I183), T185 (= T185), S187 (≠ G187)
4bmsF Short chain alcohol dehydrogenase from ralstonia sp. Dsm 6428 in complex with NADPH
53% identity, 100% coverage: 1:249/249 of query aligns to 1:249/249 of 4bmsF
- active site: S137 (= S137), H147 (≠ F147), Y150 (= Y150), K154 (= K154), Q195 (≠ T195)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), N15 (= N15), S16 (= S16), I18 (= I18), R38 (= R38), R39 (= R39), A59 (≠ G59), D60 (= D60), V61 (≠ I61), N87 (= N87), S88 (≠ A88), G89 (= G89), V110 (≠ I110), S137 (= S137), Y150 (= Y150), K154 (= K154), G181 (= G181), I183 (= I183), T185 (= T185), I187 (≠ G187)
8ijgC Crystal structure of alcohol dehydrogenase m5 from burkholderia gladioli with NADP
51% identity, 99% coverage: 3:249/249 of query aligns to 3:250/250 of 8ijgC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), T15 (≠ N15), S16 (= S16), I18 (= I18), R38 (= R38), R39 (= R39), D60 (= D60), V61 (≠ I61), N87 (= N87), G89 (= G89), R110 (≠ I110), N135 (≠ T135), A137 (≠ S137), Y150 (= Y150), K154 (= K154), P180 (= P180), G181 (= G181), T183 (≠ I183), T185 (= T185), G187 (= G187)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
41% identity, 99% coverage: 1:246/249 of query aligns to 6:252/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G13), S20 (≠ N15), K21 (≠ S16), G22 (= G17), I23 (= I18), A43 (≠ R38), S44 (≠ R39), S45 (≠ Q40), G68 (= G59), D69 (= D60), V70 (≠ I61), N96 (= N87), S97 (≠ A88), G98 (= G89), Y100 (≠ G91), I144 (≠ T135), S146 (= S137), Y159 (= Y150), K163 (= K154), P189 (= P180), G190 (= G181), M191 (≠ P182), I192 (= I183), T194 (= T185), G196 (= G194), T197 (= T195)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S137), Y159 (= Y150), M191 (≠ P182), I202 (≠ A200)
4esoB Crystal structure of a putative oxidoreductase protein from sinorhizobium meliloti 1021 in complex with NADP
39% identity, 98% coverage: 5:248/249 of query aligns to 4:246/251 of 4esoB
- active site: G16 (= G17), S136 (= S137), M146 (≠ F147), Y149 (= Y150), K153 (= K154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), T14 (≠ N15), H15 (≠ S16), M17 (≠ I18), R37 (= R38), N38 (≠ R39), N41 (≠ E42), S58 (≠ G59), D59 (= D60), I60 (= I61), N86 (= N87), A87 (= A88), G88 (= G89), T134 (= T135), S136 (= S137), Y149 (= Y150), P179 (= P180), G180 (= G181), I182 (= I183), T184 (= T185), T186 (≠ G187), K187 (≠ L188), G188 (≠ D189)
5t2uA Short chain dehydrogenase/reductase family protein (see paper)
43% identity, 98% coverage: 3:245/249 of query aligns to 3:237/241 of 5t2uA
- active site: G17 (= G17), T135 (≠ S137), T145 (≠ F147), Y148 (= Y150), K152 (= K154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), G17 (= G17), R38 (= R38), D39 (≠ R39), R42 (≠ E42), D60 (= D60), L61 (≠ I61), N83 (= N87), A84 (= A88), Y87 (≠ Q94), I133 (≠ L134), T135 (≠ S137), Y148 (= Y150), K152 (= K154), P178 (= P180), P180 (= P182), T181 (≠ I183), T183 (= T185), T185 (≠ S193), T186 (≠ G194)
6ci9D Rmm microcompartment-associated aminopropanol dehydrogenase NADP + aminoacetone holo-structure (see paper)
37% identity, 98% coverage: 1:245/249 of query aligns to 4:248/259 of 6ci9D
- active site: G20 (= G17), S145 (= S137), Y159 (= Y150)
- binding 1-aminopropan-2-one: F97 (≠ G91), S145 (= S137), T147 (= T139), W156 (≠ F147), Y159 (= Y150), G190 (= G181)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G13), S18 (≠ N15), G20 (= G17), I21 (= I18), G40 (= G37), R41 (= R38), N42 (≠ R39), D66 (= D60), V67 (≠ I61), N93 (= N87), G95 (= G89), T143 (= T135), S145 (= S137), Y159 (= Y150), K163 (= K154), P189 (= P180), N191 (≠ P182), I192 (= I183), T194 (= T185), G196 (= G187), L197 (= L188)
7ejiB Crystal structure of kred f147l/l153q/y190p/l199a/m205f/m206f variant and methyl methacrylate complex
38% identity, 98% coverage: 3:246/249 of query aligns to 3:248/251 of 7ejiB
- binding methyl 2-methylprop-2-enoate: S142 (= S137), I143 (≠ T138), Y155 (= Y150), F205 (≠ I201)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), T15 (≠ N15), L16 (≠ S16), G17 (= G17), I18 (= I18), R38 (= R38), H39 (≠ R39), D62 (= D60), A63 (≠ I61), N89 (= N87), A90 (= A88), V112 (≠ I110), M140 (≠ T135), S142 (= S137), Y155 (= Y150), K159 (= K154), P187 (= P180), P189 (= P182), I190 (= I183), T192 (= T185), P193 (= P186), L194 (≠ G187)
7ejhA Crystal structure of kred mutant-f147l/l153q/y190p/l199a/m205f/m206f and 2-hydroxyisoindoline-1,3-dione complex
38% identity, 98% coverage: 3:246/249 of query aligns to 5:250/253 of 7ejhA
- binding 2-oxidanylisoindole-1,3-dione: S144 (= S137), I145 (≠ T138), E146 (≠ T139), Y157 (= Y150), V197 (≠ L188), F207 (≠ I201)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), T17 (≠ N15), I20 (= I18), R40 (= R38), H41 (≠ R39), D64 (= D60), A65 (≠ I61), N91 (= N87), A92 (= A88), V114 (≠ I110), M142 (≠ T135), S144 (= S137), Y157 (= Y150), K161 (= K154), P189 (= P180), G190 (= G181), P191 (= P182), I192 (= I183), T194 (= T185), P195 (= P186), L196 (≠ G187)
1zk4A Structure of r-specific alcohol dehydrogenase (wildtype) from lactobacillus brevis in complex with acetophenone and NADP (see paper)
37% identity, 98% coverage: 2:246/249 of query aligns to 2:248/251 of 1zk4A
- active site: G17 (= G17), S142 (= S137), Y155 (= Y150), K159 (= K154)
- binding 1-phenylethanone: A93 (≠ G91), Y155 (= Y150), Y189 (≠ P182)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), T15 (≠ N15), L16 (≠ S16), I18 (= I18), T36 (≠ V36), G37 (= G37), R38 (= R38), H61 (≠ G59), D62 (= D60), N89 (= N87), A90 (= A88), G91 (= G89), I92 (≠ L90), Y155 (= Y150), G188 (= G181), I190 (= I183), T192 (= T185), L194 (≠ G187)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
35% identity, 99% coverage: 1:246/249 of query aligns to 2:242/244 of 4nbuB
- active site: G18 (= G17), N111 (= N111), S139 (= S137), Q149 (≠ F147), Y152 (= Y150), K156 (= K154)
- binding acetoacetyl-coenzyme a: D93 (≠ F93), K98 (≠ S98), S139 (= S137), N146 (≠ T144), V147 (≠ P145), Q149 (≠ F147), Y152 (= Y150), F184 (≠ P182), M189 (≠ G187), K200 (≠ D204)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), N17 (≠ S16), G18 (= G17), I19 (= I18), D38 (≠ E42), F39 (≠ L43), V59 (≠ G59), D60 (= D60), V61 (≠ I61), N87 (= N87), A88 (= A88), G89 (= G89), I90 (≠ L90), T137 (= T135), S139 (= S137), Y152 (= Y150), K156 (= K154), P182 (= P180), F184 (≠ P182), T185 (≠ I183), T187 (= T185), M189 (≠ G187)
Q6WVP7 NADP-dependent (R)-specific alcohol dehydrogenase; (R)-specific ADH; Ketoreductase; KRED; EC 1.1.1.- from Lentilactobacillus kefiri (Lactobacillus kefiri) (see paper)
38% identity, 98% coverage: 3:246/249 of query aligns to 4:249/252 of Q6WVP7
Sites not aligning to the query:
6y0sAAA R-specific alcohol dehydrogenase (see paper)
36% identity, 98% coverage: 2:246/249 of query aligns to 2:248/251 of 6y0sAAA
1zk1A Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and NAD (see paper)
36% identity, 98% coverage: 2:246/249 of query aligns to 2:248/251 of 1zk1A
- active site: G17 (= G17), S142 (= S137), Y155 (= Y150), K159 (= K154)
- binding 1-phenylethanone: A93 (≠ G91), N95 (≠ F93), Y155 (= Y150), Y189 (≠ P182)
- binding nicotinamide-adenine-dinucleotide: G13 (= G13), L16 (≠ S16), I18 (= I18), D37 (≠ G37), H61 (≠ G59), D62 (= D60), S63 (≠ I61), N89 (= N87), A90 (= A88), I92 (≠ L90), M140 (≠ T135), Y155 (= Y150), G188 (= G181), I190 (= I183), L194 (≠ G187)
1zjzA Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and NAD (see paper)
36% identity, 98% coverage: 2:246/249 of query aligns to 2:248/251 of 1zjzA
- active site: G17 (= G17), S142 (= S137), Y155 (= Y150), K159 (= K154)
- binding nicotinamide-adenine-dinucleotide: G13 (= G13), L16 (≠ S16), I18 (= I18), D37 (≠ G37), D62 (= D60), N89 (= N87), A90 (= A88), G91 (= G89), I92 (≠ L90), Y155 (= Y150), G188 (= G181), I190 (= I183), L194 (≠ G187)
- binding (1r)-1-phenylethanol: A93 (≠ G91), N95 (≠ F93), L152 (≠ F147), Y155 (= Y150)
1zjyA Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and nadh (see paper)
36% identity, 98% coverage: 2:246/249 of query aligns to 2:248/251 of 1zjyA
- active site: G17 (= G17), S142 (= S137), Y155 (= Y150), K159 (= K154)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G13 (= G13), L16 (≠ S16), G17 (= G17), I18 (= I18), D37 (≠ G37), D62 (= D60), N89 (= N87), A90 (= A88), G91 (= G89), I92 (≠ L90), Y155 (= Y150), G188 (= G181), I190 (= I183), L194 (≠ G187)
- binding (1r)-1-phenylethanol: A93 (≠ G91), N95 (≠ F93), L152 (≠ F147), Y155 (= Y150), Y189 (≠ P182)
3r3sA Structure of the ygha oxidoreductase from salmonella enterica
38% identity, 98% coverage: 3:245/249 of query aligns to 44:288/292 of 3r3sA
- active site: G58 (= G17), S184 (= S137), L194 (≠ F147), Y197 (= Y150), K201 (= K154), Q242 (≠ E199)
- binding magnesium ion: D56 (≠ N15), S57 (= S16), E82 (≠ R39)
- binding nicotinamide-adenine-dinucleotide: D56 (≠ N15), S57 (= S16), G58 (= G17), I59 (= I18), L79 (≠ V36), E82 (≠ R39), D106 (= D60), L107 (≠ I61), V133 (≠ N87), A134 (= A88), G135 (= G89), S184 (= S137), Y197 (= Y150), K201 (= K154), P227 (= P180), G228 (= G181), I230 (= I183), T232 (= T185), L234 (= L190), Q235 (≠ A191)
P0AG84 Uncharacterized oxidoreductase YghA; EC 1.-.-.- from Escherichia coli (strain K12) (see paper)
39% identity, 98% coverage: 3:245/249 of query aligns to 46:290/294 of P0AG84
Sites not aligning to the query:
- 39 modified: N6-acetyllysine
6xewA Structure of serratia marcescens 2,3-butanediol dehydrogenase (see paper)
35% identity, 98% coverage: 3:245/249 of query aligns to 2:240/251 of 6xewA
- active site: G16 (= G17), S138 (= S137), Y151 (= Y150)
- binding r,3-hydroxybutan-2-one: S138 (= S137), S140 (≠ T139), Y151 (= Y150)
- binding s,3-hydroxybutan-2-one: S138 (= S137), Y151 (= Y150), S182 (≠ G181)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), N15 (≠ S16), G16 (= G17), M17 (≠ I18), D36 (≠ G37), W37 (≠ R38), W37 (≠ R38), A38 (≠ R39), I59 (≠ G59), D60 (= D60), V61 (≠ I61), N87 (= N87), A88 (= A88), G89 (= G89), V110 (≠ I110), T136 (= T135), S138 (= S137), Y151 (= Y150), K155 (= K154), S182 (≠ G181), L183 (≠ P182), V184 (≠ I183), T186 (= T185), N187 (≠ P186), M188 (≠ G187), T189 (≠ L188)
6vspA Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
35% identity, 98% coverage: 3:245/249 of query aligns to 2:240/251 of 6vspA
- active site: G16 (= G17), S138 (= S137), Y151 (= Y150)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), N15 (≠ S16), G16 (= G17), M17 (≠ I18), D36 (≠ G37), W37 (≠ R38), W37 (≠ R38), A38 (≠ R39), I59 (≠ G59), D60 (= D60), V61 (≠ I61), N87 (= N87), A88 (= A88), G89 (= G89), V90 (≠ L90), V110 (≠ I110), T136 (= T135), S138 (= S137), Y151 (= Y150), K155 (= K154), P181 (= P180), S182 (≠ G181), L183 (≠ P182), V184 (≠ I183), T186 (= T185), N187 (≠ P186), M188 (≠ G187), T189 (≠ L188)
Query Sequence
>GFF2696 FitnessBrowser__WCS417:GFF2696
MSRLNGKIAVVTGGNSGIGLATAIRFATEGAQVVIVGRRQDELDKALALIGHEAIAIQGD
ISKLDDLARIFTQIKADKGRVDVLFANAGLGDFQPIGSITEESFDRTFGINVKGTLFTVQ
NALPLMHAGSSVILTGSTTGTMGTPAFSVYSATKAALRNFARSWALDLKGSGIRVNVLSP
GPISTPGLDLALSGTGQKEAIIDDMTAQVPLGRIGKPEEVAAAALFLASDESSFMTGSEM
FVDGGFAQV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory