SitesBLAST
Comparing GFF2697 FitnessBrowser__Phaeo:GFF2697 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4hp8B Crystal structure of a putative 2-deoxy-d-gluconate 3-dehydrogenase from agrobacterium tumefaciens (target efi-506435) with bound NADP
43% identity, 97% coverage: 9:257/258 of query aligns to 4:245/246 of 4hp8B
- active site: G19 (= G24), S138 (= S150), V148 (≠ R160), Y151 (= Y163), K155 (= K167)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G20), N17 (≠ S22), T18 (≠ S23), G19 (= G24), L20 (≠ I25), R40 (= R45), R41 (= R46), D63 (= D70), F64 (≠ V71), N85 (≠ S97), G87 (= G99), I88 (≠ L100), I136 (= I148), Y151 (= Y163), K155 (= K167), P181 (= P193), G182 (≠ T194), I184 (= I196), T186 (= T198), N188 (≠ L200), T189 (= T201)
Q920P0 L-xylulose reductase; XR; Dicarbonyl/L-xylulose reductase; EC 1.1.1.10 from Rattus norvegicus (Rat) (see paper)
38% identity, 96% coverage: 11:257/258 of query aligns to 5:243/244 of Q920P0
- S136 (= S150) mutation to A: Loss of activity.
- Q137 (= Q151) mutation to M: Slightly reduced activity. Loss of activity for sugars; when associated with F-143 and L-146.
- L143 (≠ G157) mutation to F: Slightly reduced activity. Loss of activity for sugars; when associated with M-137 and L-146.
- H146 (≠ R160) mutation to L: Slightly reduced activity. Loss of activity for sugars; when associated with M-137; F-143 and L-146.
- Y149 (= Y163) mutation to F: Loss of activity.
- K153 (= K167) mutation to M: Loss of activity.
- N190 (≠ T204) mutation to V: Slightly reduced activity. Loss of activity for sugars; when associated with S-191.
- W191 (≠ F205) mutation to F: Slightly reduced activity.; mutation to S: Slightly reduced activity. Loss of activity for sugars; when associated with V-190.
4za2D Crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d- gluconate dehydrogenase complexed with NAD+ (see paper)
38% identity, 97% coverage: 8:257/258 of query aligns to 5:246/247 of 4za2D
- binding nicotinamide-adenine-dinucleotide: G17 (= G20), D19 (≠ S22), L22 (≠ I25), I42 (≠ R46), D65 (= D70), M66 (≠ V71), N92 (≠ S97), A93 (= A98), G94 (= G99), L115 (= L120), I143 (= I148), S145 (= S150), Y158 (= Y163), K162 (= K167), G189 (≠ T194), M191 (≠ I196), T193 (= T198), N195 (≠ L200)
5u9pB Crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP and tartrate
38% identity, 97% coverage: 9:257/258 of query aligns to 12:259/261 of 5u9pB
- active site: G27 (= G24), S152 (= S150), Y165 (= Y163), K169 (= K167)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G20), R26 (≠ S23), G27 (= G24), I28 (= I25), R48 (= R45), D73 (= D70), V74 (= V71), N100 (≠ S97), A101 (= A98), I150 (= I148), Y165 (= Y163), K169 (= K167), P195 (= P193), F198 (≠ I196), T200 (= T198), L202 (= L200), N203 (≠ T201)
3uf0A Crystal structure of a putative NAD(p) dependent gluconate 5- dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound NADP (low occupancy)
38% identity, 97% coverage: 9:257/258 of query aligns to 3:248/249 of 3uf0A
- active site: G18 (= G24), S141 (= S150), V151 (≠ R160), Y154 (= Y163), K158 (= K167)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G20), S17 (= S23), G18 (= G24), I19 (= I25), R39 (= R46), D63 (= D70), L64 (≠ V71), N89 (≠ S97), G91 (= G99), I92 (≠ L100), I139 (= I148), A140 (≠ S149), S141 (= S150), Y154 (= Y163), K158 (= K167), P184 (= P193), G185 (≠ T194), V187 (≠ I196), T189 (= T198), N191 (≠ L200), T192 (= T201)
3d3wA Structure of l-xylulose reductase with bound coenzyme, phosphate and hydroxide. (see paper)
36% identity, 96% coverage: 11:257/258 of query aligns to 5:243/244 of 3d3wA
- active site: G18 (= G24), S136 (= S150), H146 (≠ R160), Y149 (= Y163), K153 (= K167)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G20), G16 (≠ S22), K17 (≠ S23), G18 (= G24), I19 (= I25), S38 (≠ A44), R39 (= R45), T40 (≠ R46), V59 (≠ L69), L61 (≠ V71), N83 (≠ S97), A84 (= A98), A85 (≠ G99), V106 (≠ L120), V134 (≠ I148), S135 (= S149), S136 (= S150), Y149 (= Y163), K153 (= K167), P179 (= P193), T180 (= T194), V182 (≠ I196), T184 (= T198), S185 (≠ P199), M186 (≠ L200), G187 (≠ T201)
1pr9A Human l-xylulose reductase holoenzyme (see paper)
36% identity, 96% coverage: 11:257/258 of query aligns to 5:243/244 of 1pr9A
- active site: G18 (= G24), S136 (= S150), H146 (≠ R160), Y149 (= Y163), K153 (= K167)
- binding dihydrogenphosphate ion: S136 (= S150), C138 (≠ M152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G20), G16 (≠ S22), K17 (≠ S23), G18 (= G24), I19 (= I25), S38 (≠ A44), R39 (= R45), T40 (≠ R46), L61 (≠ V71), N83 (≠ S97), A85 (≠ G99), V106 (≠ L120), V134 (≠ I148), Y149 (= Y163), K153 (= K167), T180 (= T194), V182 (≠ I196), T184 (= T198), M186 (≠ L200)
Q7Z4W1 L-xylulose reductase; XR; Carbonyl reductase II; Dicarbonyl/L-xylulose reductase; Kidney dicarbonyl reductase; kiDCR; Short chain dehydrogenase/reductase family 20C member 1; Sperm surface protein P34H; EC 1.1.1.10 from Homo sapiens (Human) (see 2 papers)
36% identity, 96% coverage: 11:257/258 of query aligns to 5:243/244 of Q7Z4W1
- 11:40 (vs. 17:46, 50% identical) binding
- N107 (= N121) mutation N->L,D: Loss of function. Probably due to defects in formation of the active site and binding of coenzyme.
- S136 (= S150) binding
- K153 (= K167) binding
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
36% identity, 97% coverage: 9:257/258 of query aligns to 2:251/252 of 1vl8B
- active site: G17 (= G24), S143 (= S150), I154 (≠ R160), Y157 (= Y163), K161 (= K167)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G20), R16 (≠ S23), G17 (= G24), L18 (≠ I25), S37 (≠ A44), R38 (= R45), C63 (≠ L69), D64 (= D70), V65 (= V71), A91 (≠ S97), A92 (= A98), G93 (= G99), I94 (≠ L100), V114 (≠ L120), I141 (= I148), S143 (= S150), Y157 (= Y163), K161 (= K167), P187 (= P193), G188 (≠ T194), Y190 (≠ I196), T192 (= T198), M194 (≠ L200), T195 (= T201)
3o03A Quaternary complex structure of gluconate 5-dehydrogenase from streptococcus suis type 2 (see paper)
38% identity, 97% coverage: 8:257/258 of query aligns to 6:248/254 of 3o03A
- active site: G22 (= G24), S147 (= S150), V157 (≠ R160), Y160 (= Y163), K164 (= K167)
- binding calcium ion: S147 (= S150), M148 (≠ Q151), P190 (= P193)
- binding D-gluconic acid: I99 (≠ A101), R101 (≠ H103), S147 (= S150), M149 (= M152), R154 (≠ G157), Y160 (= Y163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G20), Y21 (≠ S23), G22 (= G24), I23 (= I25), D42 (≠ A44), I43 (≠ R45), L47 (≠ P49), D68 (= D70), V69 (= V71), N95 (≠ S97), A96 (= A98), G97 (= G99), I145 (= I148), Y160 (= Y163), K164 (= K167), P190 (= P193)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
40% identity, 93% coverage: 14:254/258 of query aligns to 5:243/246 of 3osuA
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
40% identity, 93% coverage: 14:254/258 of query aligns to 2:236/239 of 3sj7A
- active site: G12 (= G24), S138 (= S150), Q148 (≠ R160), Y151 (= Y163), K155 (= K167)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G20), S10 (= S22), R11 (≠ S23), I13 (= I25), N31 (≠ A43), Y32 (vs. gap), A33 (= A44), G34 (≠ R45), S35 (≠ R46), A58 (≠ L69), N59 (≠ D70), V60 (= V71), N86 (≠ S97), A87 (= A98), T109 (≠ L120), S138 (= S150), Y151 (= Y163), K155 (= K167), P181 (= P193), G182 (≠ T194)
3ak4A Crystal structure of nadh-dependent quinuclidinone reductase from agrobacterium tumefaciens
38% identity, 95% coverage: 9:254/258 of query aligns to 3:254/258 of 3ak4A
- active site: G18 (= G24), S141 (= S150), L151 (≠ R160), Y154 (= Y163), K158 (= K167), E199 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: K17 (≠ S23), G18 (= G24), I19 (= I25), D38 (≠ A44), L39 (≠ R45), V60 (= V66), D61 (= D70), V62 (= V71), N88 (≠ S97), A89 (= A98), G90 (= G99), T139 (≠ I148), S141 (= S150), Y154 (= Y163), K158 (= K167), G185 (≠ T194), V187 (≠ I196), T189 (= T198), M191 (≠ L200)
A7DY56 Tropinone reductase; EC 1.1.1.206; EC 1.1.1.236 from Cochlearia officinalis (Common scurvygrass) (see paper)
35% identity, 96% coverage: 9:256/258 of query aligns to 14:261/273 of A7DY56
- Y209 (≠ T204) mutation to S: Loss of tropinone or nortropinone reduction, but faster reduction of cyclohexanones.
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
36% identity, 95% coverage: 11:254/258 of query aligns to 2:241/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G20), M16 (≠ I25), D35 (≠ A44), I36 (≠ R45), I62 (≠ V71), N88 (≠ S97), G90 (= G99), I138 (= I148), S140 (= S150), Y152 (= Y163), K156 (= K167), I185 (= I196)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
36% identity, 95% coverage: 11:254/258 of query aligns to 3:242/248 of Q9KJF1
- S15 (= S23) binding
- D36 (≠ A44) binding
- D62 (= D70) binding
- I63 (≠ V71) binding
- N89 (≠ S97) binding
- Y153 (= Y163) binding
- K157 (= K167) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
5gwrA 4-hydroxyisoleucine dehydrogenase complexed with nadh (see paper)
36% identity, 95% coverage: 13:257/258 of query aligns to 1:241/243 of 5gwrA
- active site: G12 (= G24), S134 (= S150), Y147 (= Y163), K151 (= K167)
- binding nicotinamide-adenine-dinucleotide: G8 (= G20), S11 (= S23), G12 (= G24), I13 (= I25), D32 (≠ R46), I33 (= I47), I53 (≠ L69), L55 (≠ V71), A81 (≠ S97), G83 (= G99), I84 (≠ L100), I132 (= I148), S134 (= S150), Y147 (= Y163), K151 (= K167), P177 (= P193), G178 (≠ T194), I180 (= I196), T182 (= T198), L184 (= L200), T185 (= T201)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
38% identity, 95% coverage: 11:254/258 of query aligns to 3:244/247 of 4jroC
- active site: G16 (= G24), S142 (= S150), Q152 (≠ R160), Y155 (= Y163), K159 (= K167)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G20), S14 (= S22), R15 (≠ S23), G16 (= G24), I17 (= I25), N35 (vs. gap), Y36 (vs. gap), N37 (vs. gap), G38 (vs. gap), S39 (≠ A43), N63 (≠ D70), V64 (= V71), N90 (≠ S97), A91 (= A98), I93 (≠ L100), I113 (≠ L120), S142 (= S150), Y155 (= Y163), K159 (= K167), P185 (= P193), I188 (= I196), T190 (= T198)
Q9ZW19 Tropinone reductase homolog At2g29360; EC 1.1.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 99% coverage: 2:256/258 of query aligns to 7:261/271 of Q9ZW19
- S209 (≠ T204) mutation to Y: Loss of activity with quinuclidinone and decreased activity with cyclohexanones.
Q48436 Diacetyl reductase [(S)-acetoin forming]; Acetoin(diacetyl) reductase; AR; Meso-2,3-butanediol dehydrogenase; EC 1.1.1.304 from Klebsiella pneumoniae (see paper)
36% identity, 93% coverage: 14:254/258 of query aligns to 3:252/256 of Q48436
- 6:33 (vs. 17:44, 54% identical) binding
- D59 (= D70) binding
- K156 (= K167) binding
Query Sequence
>GFF2697 FitnessBrowser__Phaeo:GFF2697
MTLPRTPSFRLDGKRALVTGASSGIGRACAVALAEAGAHVTIAARRIEPLEALVAEMQAA
DMQAEVMVLDVADIAATRASISERITQNGAFDILVNSAGLARHSPASDTTEGDFDAVIDL
NIKGAYFLTQAVAKGLMAAGKPGSLINISSQMAKVGGLDRAVYSATKHAVEGFTKSMAIE
WGKSGIRVNTICPTFIVTPLTQSTFDRPERRAWIESKIQLGRIGEVEDIMGGVVYLASDA
SSLITGTALMIDGGWTAE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory