SitesBLAST
Comparing GFF2700 FitnessBrowser__WCS417:GFF2700 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3i3oA 2.06 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'Ames ancestor' in complex with NAD-acetone
52% identity, 95% coverage: 12:281/285 of query aligns to 7:277/282 of 3i3oA
- active site: G49 (= G53), S174 (= S178), L184 (= L188), Y187 (= Y191), K191 (= K195), K232 (≠ E236)
- binding magnesium ion: D47 (= D51), S48 (= S52), E72 (= E76)
- binding nicotinamide adenine dinucleotide acetone adduct: G45 (= G49), D47 (= D51), S48 (= S52), G49 (= G53), I50 (= I54), Y69 (= Y73), L70 (= L74), E72 (= E76), G95 (= G99), D96 (= D100), L97 (≠ I101), N123 (= N127), V124 (≠ A128), A125 (= A129), Q126 (≠ F130), Q127 (= Q131), I147 (= I151), T172 (= T176), S174 (= S178), Y187 (= Y191), K191 (= K195), P217 (= P221), G218 (= G222), I220 (= I224), T222 (= T226), L224 (= L228)
3ijrF 2.05 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'Ames ancestor' in complex with NAD+
52% identity, 95% coverage: 12:281/285 of query aligns to 15:285/290 of 3ijrF
- active site: G57 (= G53), S182 (= S178), L192 (= L188), Y195 (= Y191), K199 (= K195), K240 (≠ E236)
- binding magnesium ion: D55 (= D51), S56 (= S52), E80 (= E76)
- binding nicotinamide-adenine-dinucleotide: P21 (= P17), D55 (= D51), S56 (= S52), G57 (= G53), I58 (= I54), Y77 (= Y73), L78 (= L74), E80 (= E76), G103 (= G99), D104 (= D100), L105 (≠ I101), N131 (= N127), V132 (≠ A128), A133 (= A129), Q134 (≠ F130), I155 (= I151), T180 (= T176), S182 (= S178), Y195 (= Y191), K199 (= K195), P225 (= P221), G226 (= G222), P227 (= P223), I228 (= I224), T230 (= T226), L232 (= L228)
5jydB Crystal structure of a putative short chain dehydrogenase from burkholderia cenocepacia
51% identity, 99% coverage: 4:285/285 of query aligns to 9:292/292 of 5jydB
- active site: G58 (= G53), S184 (= S178), L194 (= L188), Y197 (= Y191), K201 (= K195), P242 (≠ D235)
- binding magnesium ion: D56 (= D51), S57 (= S52), E82 (= E76)
- binding nicotinamide-adenine-dinucleotide: G54 (= G49), D56 (= D51), S57 (= S52), G58 (= G53), I59 (= I54), L79 (= L74), E82 (= E76), D106 (= D100), I107 (= I101), N133 (= N127), A134 (= A128), A135 (= A129), T182 (= T176), S184 (= S178), Y197 (= Y191), K201 (= K195), P227 (= P221), G228 (= G222), P229 (= P223), Y230 (≠ I224), T232 (= T226), L234 (= L228), Q235 (≠ I229)
3r3sA Structure of the ygha oxidoreductase from salmonella enterica
49% identity, 99% coverage: 3:284/285 of query aligns to 13:291/292 of 3r3sA
- active site: G58 (= G53), S184 (= S178), L194 (= L188), Y197 (= Y191), K201 (= K195), Q242 (≠ D235)
- binding magnesium ion: D56 (= D51), S57 (= S52), E82 (= E76)
- binding nicotinamide-adenine-dinucleotide: D56 (= D51), S57 (= S52), G58 (= G53), I59 (= I54), L79 (= L74), E82 (= E76), D106 (= D100), L107 (≠ I101), V133 (≠ N127), A134 (= A128), G135 (≠ A129), S184 (= S178), Y197 (= Y191), K201 (= K195), P227 (= P221), G228 (= G222), I230 (= I224), T232 (= T226), L234 (= L228), Q235 (vs. gap)
P0AG84 Uncharacterized oxidoreductase YghA; EC 1.-.-.- from Escherichia coli (strain K12) (see paper)
48% identity, 99% coverage: 3:284/285 of query aligns to 15:293/294 of P0AG84
- K39 (≠ Q32) modified: N6-acetyllysine
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
38% identity, 85% coverage: 39:281/285 of query aligns to 8:251/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G49), S20 (≠ D51), K21 (≠ S52), G22 (= G53), I23 (= I54), A43 (≠ L74), S44 (≠ D75), S45 (≠ E76), G68 (= G99), D69 (= D100), V70 (≠ I101), N96 (= N127), S97 (≠ A128), G98 (≠ A129), Y100 (≠ M132), I144 (≠ T176), S146 (= S178), Y159 (= Y191), K163 (= K195), P189 (= P221), G190 (= G222), M191 (≠ P223), I192 (= I224), T194 (= T226), G196 (≠ L228), T197 (≠ I229)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S178), Y159 (= Y191), M191 (≠ P223), I202 (vs. gap)
3ay6B Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose (see paper)
36% identity, 85% coverage: 40:281/285 of query aligns to 11:255/267 of 3ay6B
- active site: G24 (= G53), S151 (= S178), Y164 (= Y191), K168 (= K195)
- binding beta-D-glucopyranose: E102 (≠ Q131), S151 (= S178), H153 (≠ N180), W158 (≠ K185), Y164 (= Y191), N202 (≠ I229), K205 (≠ T232)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G49), T23 (≠ S52), G24 (= G53), L25 (≠ I54), Y45 (≠ L74), D71 (= D100), V72 (≠ I101), N98 (= N127), A99 (= A128), G100 (≠ A129), V101 (≠ F130), M149 (≠ T176), S151 (= S178), Y164 (= Y191), K168 (= K195), P194 (= P221), G195 (= G222), M197 (≠ I224), T199 (= T226), P200 (= P227), I201 (≠ L228), N202 (≠ I229)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
36% identity, 84% coverage: 43:281/285 of query aligns to 2:236/239 of 3sj7A
- active site: G12 (= G53), S138 (= S178), Q148 (≠ L188), Y151 (= Y191), K155 (= K195)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G49), S10 (≠ D51), R11 (≠ S52), I13 (= I54), N31 (≠ A72), Y32 (= Y73), A33 (≠ L74), G34 (≠ D75), S35 (≠ E76), A58 (≠ G99), N59 (≠ D100), V60 (≠ I101), N86 (= N127), A87 (= A128), T109 (≠ I151), S138 (= S178), Y151 (= Y191), K155 (= K195), P181 (= P221), G182 (= G222)
P40288 Glucose 1-dehydrogenase; EC 1.1.1.47 from Priestia megaterium (Bacillus megaterium) (see 2 papers)
34% identity, 85% coverage: 40:281/285 of query aligns to 5:249/261 of P40288
- 11:35 (vs. 46:70, 48% identical) binding
- E96 (≠ Q131) mutation E->A,G,K: Heat stable.
- D108 (≠ E144) mutation to N: Heat stable.
- V112 (≠ T148) mutation to A: Heat stable.
- E133 (≠ A169) mutation to K: Heat stable.
- V183 (= V216) mutation to I: Heat stable.
- P194 (= P227) mutation to Q: Heat stable.
- E210 (≠ G242) mutation to K: Heat stable.
- Y217 (≠ R249) mutation to H: Heat stable.
Sites not aligning to the query:
- 252 Q→L: Heat stable.
- 253 Y→C: Heat stable.
- 258 A→G: Heat stable.
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
37% identity, 85% coverage: 39:281/285 of query aligns to 2:247/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G49), Q15 (≠ S52), G16 (= G53), I17 (= I54), D36 (≠ Y73), V63 (≠ I101), N89 (= N127), A91 (= A129), S94 (vs. gap), I142 (≠ T176), S143 (= S177), S144 (= S178), Y157 (= Y191), K161 (= K195), P187 (= P221), H188 (≠ G222), I190 (= I224), I194 (≠ L228)
1g6kA Crystal structure of glucose dehydrogenase mutant e96a complexed with NAD+
34% identity, 85% coverage: 40:281/285 of query aligns to 5:249/261 of 1g6kA
- active site: G18 (= G53), S145 (= S178), Y158 (= Y191), K162 (= K195)
- binding nicotinamide-adenine-dinucleotide: T17 (≠ S52), G18 (= G53), L19 (≠ I54), R39 (≠ L74), D65 (= D100), V66 (≠ I101), N92 (= N127), A93 (= A128), G94 (≠ A129), M143 (≠ T176), S145 (= S178), Y158 (= Y191), P188 (= P221), G189 (= G222), I191 (= I224), T193 (= T226)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
35% identity, 84% coverage: 43:281/285 of query aligns to 5:243/246 of 3osuA
8bcjB Crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 in complex with NADP+
37% identity, 84% coverage: 43:282/285 of query aligns to 5:250/250 of 8bcjB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G49), S13 (≠ D51), R14 (≠ S52), G15 (= G53), I16 (= I54), L36 (= L74), R37 (≠ D75), N38 (≠ E76), A61 (≠ G99), D62 (= D100), V63 (≠ I101), N89 (= N127), A90 (= A128), G91 (≠ A129), T113 (≠ I151), V143 (≠ T176), S145 (= S178), Y159 (= Y191), K163 (= K195), P189 (= P221), G190 (= G222), I192 (= I224), T194 (= T226), I196 (≠ L228), H197 (≠ I229)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
33% identity, 86% coverage: 38:281/285 of query aligns to 1:244/248 of 6ixmC
- active site: G16 (= G53), S142 (= S178), Y155 (= Y191), K159 (= K195)
- binding nicotinamide-adenine-dinucleotide: G12 (= G49), S15 (= S52), G16 (= G53), I17 (= I54), D36 (≠ Y73), I37 (≠ L74), A61 (≠ G99), D62 (= D100), T63 (≠ I101), N89 (= N127), A90 (= A128), M140 (≠ T176), S142 (= S178), Y155 (= Y191), K159 (= K195), P185 (= P221), A186 (≠ G222), Y187 (≠ P223), I188 (= I224), L192 (= L228)
4iqgD Crystal structure of bpro0239 oxidoreductase from polaromonas sp. Js666 in NADP bound form
36% identity, 85% coverage: 42:282/285 of query aligns to 2:248/248 of 4iqgD
- active site: G13 (= G53), N112 (= N152), S143 (= S178), Y154 (≠ L188), Y157 (= Y191), K161 (= K195)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G49), S11 (≠ D51), R12 (≠ S52), G13 (= G53), I14 (= I54), N32 (≠ A72), A34 (≠ L74), S35 (≠ D75), N36 (≠ E76), A59 (≠ G99), D60 (= D100), V61 (≠ I101), N87 (= N127), A88 (= A128), G89 (≠ A129), V141 (≠ T176), S143 (= S178), Y157 (= Y191), K161 (= K195), P187 (= P221), G188 (= G222), I190 (= I224), T192 (= T226), I194 (≠ L228), H195 (≠ I229)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
34% identity, 85% coverage: 39:281/285 of query aligns to 4:241/244 of 4nbuB
- active site: G18 (= G53), N111 (= N152), S139 (= S178), Q149 (≠ L188), Y152 (= Y191), K156 (= K195)
- binding acetoacetyl-coenzyme a: D93 (≠ S133), K98 (≠ E139), S139 (= S178), N146 (≠ K185), V147 (≠ P186), Q149 (≠ L188), Y152 (= Y191), F184 (≠ P223), M189 (≠ L228), K200 (≠ N240)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G49), N17 (≠ S52), G18 (= G53), I19 (= I54), D38 (≠ Y73), F39 (≠ L74), V59 (≠ G99), D60 (= D100), V61 (≠ I101), N87 (= N127), A88 (= A128), G89 (≠ A129), I90 (≠ F130), T137 (= T176), S139 (= S178), Y152 (= Y191), K156 (= K195), P182 (= P221), F184 (≠ P223), T185 (≠ I224), T187 (= T226), M189 (≠ L228)
4bmsF Short chain alcohol dehydrogenase from ralstonia sp. Dsm 6428 in complex with NADPH
38% identity, 85% coverage: 39:281/285 of query aligns to 3:245/249 of 4bmsF
- active site: S137 (= S178), H147 (≠ L188), Y150 (= Y191), K154 (= K195), Q195 (≠ M233)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G49), N15 (≠ D51), S16 (= S52), I18 (= I54), R38 (≠ E78), R39 (≠ D79), A59 (≠ G99), D60 (= D100), V61 (≠ I101), N87 (= N127), S88 (≠ A128), G89 (≠ A129), V110 (≠ I151), S137 (= S178), Y150 (= Y191), K154 (= K195), G181 (= G222), I183 (= I224), T185 (= T226), I187 (≠ L228)
1nfqA Rv2002 gene product from mycobacterium tuberculosis (see paper)
39% identity, 86% coverage: 37:281/285 of query aligns to 1:236/244 of 1nfqA
- active site: G17 (= G53), S139 (= S178), Y152 (= Y191), K156 (= K195)
- binding Androsterone: L91 (≠ M132), E141 (≠ N180), C149 (≠ L188), Y152 (= Y191), V193 (vs. gap), I197 (≠ V238), F198 (≠ S243)
- binding 1,4-dihydronicotinamide adenine dinucleotide: R16 (≠ S52), G17 (= G53), M18 (≠ I54), D37 (vs. gap), L39 (= L74), L59 (= L96), D60 (= D100), V61 (≠ I101), N87 (= N127), A88 (= A128), I137 (≠ T176), S139 (= S178), Y152 (= Y191), K156 (= K195), P182 (= P221), V185 (≠ I224), T187 (= T226), P188 (= P227), M189 (= M233), T190 (= T234)
1nffA Crystal structure of rv2002 gene product from mycobacterium tuberculosis (see paper)
39% identity, 86% coverage: 37:281/285 of query aligns to 1:236/244 of 1nffA
- active site: G17 (= G53), S139 (= S178), Y152 (= Y191), K156 (= K195)
- binding nicotinamide-adenine-dinucleotide: G13 (= G49), R16 (≠ S52), G17 (= G53), M18 (≠ I54), D37 (vs. gap), I38 (≠ Y73), L39 (= L74), L59 (= L96), D60 (= D100), V61 (≠ I101), N87 (= N127), A88 (= A128), G89 (≠ A129), I90 (≠ F130), I137 (≠ T176), S139 (= S178), Y152 (= Y191), K156 (= K195), P182 (= P221), V185 (≠ I224), T187 (= T226), P188 (= P227), M189 (= M233), T190 (= T234)
6gtuA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with fragment j6
34% identity, 78% coverage: 61:281/285 of query aligns to 25:245/268 of 6gtuA
- active site: S138 (= S178), Y151 (= Y191), K155 (= K195)
- binding N-(1,3-benzodioxol-5-ylmethyl)cyclopentanamine: N183 (≠ P223)
- binding nicotinamide-adenine-dinucleotide: D37 (≠ Y73), K38 (≠ L74), D59 (= D100), N86 (= N127), A87 (= A128), G88 (≠ A129), L110 (≠ I151), S138 (= S178), Y151 (= Y191), K155 (= K195), G182 (= G222), I184 (= I224), T186 (= T226), L188 (= L228)
Sites not aligning to the query:
Query Sequence
>GFF2700 FitnessBrowser__WCS417:GFF2700
MADYPRPPFAPQAQNVPGSQKKMDPYPDCGEQSYKGSGRLANKIALITGADSGIGRAVAI
AFAREGADVAIAYLDEHEDARETARWVEEAGRQCLLLPGDIAQKSVCQSLVDKTVEQFGR
IDVLVNNAAFQMSHETLEEISDEEWVKTFDINITAMFRICKAAVPHMKAGSSIINTSSVN
SDMPKPTLMPYAATKGAIANFTGGLAQLLGSKGIRVNSVAPGPIWTPLIVATMTDEDVKN
FGSETPLGRPGQPVEVAPIYVLLASDEGSYISGSRYAVTGGKPIL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory