SitesBLAST
Comparing GFF272 FitnessBrowser__WCS417:GFF272 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
71% identity, 99% coverage: 5:310/310 of query aligns to 3:308/308 of 6wj9B
- active site: A119 (≠ S121), A120 (= A122), A121 (= A123), F144 (≠ Y146), K148 (= K150)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), F12 (= F14), I13 (= I15), D32 (= D34), D33 (≠ N35), S35 (= S37), T36 (= T38), G37 (= G39), D55 (= D57), A56 (≠ V58), L75 (= L77), A76 (= A78), A77 (= A79), S94 (≠ A96), A117 (= A119), A119 (≠ S121), F144 (≠ Y146), K148 (= K150), F171 (= F173), F172 (= F174), I174 (= I176)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (= V83), N173 (= N175), G187 (= G189), V188 (= V190), F192 (= F194), T203 (= T205), L204 (≠ V206), F205 (= F207), R212 (= R214), L248 (= L250), R271 (= R273), D274 (= D276)
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
71% identity, 99% coverage: 5:310/310 of query aligns to 2:307/307 of 6wjaA
- active site: A118 (≠ S121), A119 (= A122), A120 (= A123), F143 (≠ Y146), K147 (= K150)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (= I15), D31 (= D34), D32 (≠ N35), S34 (= S37), T35 (= T38), G36 (= G39), A55 (≠ V58), L74 (= L77), A75 (= A78), A76 (= A79), S93 (≠ A96), F143 (≠ Y146), K147 (= K150), F170 (= F173), F171 (= F174), I173 (= I176)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (= V83), A120 (= A123), N172 (= N175), G186 (= G189), V187 (= V190), F191 (= F194), T202 (= T205), F204 (= F207), R211 (= R214), L247 (= L250), R270 (= R273), D273 (= D276)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
39% identity, 96% coverage: 6:303/310 of query aligns to 3:297/309 of 4zrnA
- active site: T117 (≠ S121), G119 (vs. gap), A120 (= A123), Y143 (= Y146), K147 (= K150), Y181 (≠ S184), G185 (= G189)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (= I15), D31 (= D34), N32 (= N35), S34 (= S37), S35 (≠ T38), G36 (= G39), S51 (≠ D57), I52 (≠ V58), L73 (= L77), A74 (= A78), A75 (= A79), T92 (≠ A96), S115 (≠ A119), S116 (= S120), Y143 (= Y146), K147 (= K150), Y170 (≠ F173), V173 (≠ I176)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S121), G119 (vs. gap), A120 (= A123), Y143 (= Y146), N172 (= N175), G185 (= G189), V186 (= V190), H201 (≠ T205), F203 (= F207), Y208 (≠ Q212), R210 (= R214), V244 (≠ L250), R267 (= R273), D270 (= D276)
6dntA Udp-n-acetylglucosamine 4-epimerase from methanobrevibacter ruminantium m1 in complex with udp-n-acetylmuramic acid (see paper)
38% identity, 93% coverage: 1:287/310 of query aligns to 1:283/310 of 6dntA
- active site: S120 (= S121), S121 (≠ A122), A122 (= A123), Y144 (= Y146), K148 (= K150), A187 (≠ G189)
- binding (2R)-2-{[(2R,3R,4R,5S,6R)-3-(acetylamino)-2-{[(S)-{[(R)-{[(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methoxy}(hydroxy)phosphoryl]oxy}(hydroxy)phosphoryl]oxy}-5-hydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-4-yl]oxy}propanoic acid: A80 (= A81), S120 (= S121), S121 (≠ A122), Y144 (= Y146), F172 (= F174), N173 (= N175), A187 (≠ G189), V188 (= V190), K191 (≠ I193), V203 (≠ T205), I204 (≠ V206), Y205 (≠ F207), Q210 (= Q212), R212 (= R214), I246 (≠ L250), R269 (= R273), D272 (= D276)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), G13 (= G13), F14 (= F14), I15 (= I15), D33 (= D34), N34 (= N35), L35 (= L36), S36 (= S37), S37 (≠ T38), G38 (= G39), D57 (= D57), L58 (≠ V58), L76 (= L77), A77 (= A78), A78 (= A79), A80 (= A81), S118 (≠ A119), S119 (= S120), Y144 (= Y146), K148 (= K150), Y171 (≠ F173), V174 (≠ I176)
- binding zinc ion: E209 (= E211), H275 (= H279)
2p5uA Crystal structure of thermus thermophilus hb8 udp-glucose 4-epimerase complex with NAD
39% identity, 94% coverage: 5:295/310 of query aligns to 2:293/311 of 2p5uA
- active site: T117 (≠ S121), G119 (≠ A122), A120 (= A123), Y143 (= Y146), K147 (= K150), H181 (≠ S184), G185 (= G189)
- binding nicotinamide-adenine-dinucleotide: G10 (= G13), F11 (= F14), I12 (= I15), D31 (= D34), N32 (= N35), L33 (= L36), A34 (≠ S37), T35 (= T38), G36 (= G39), D51 (= D57), L52 (≠ V58), Q73 (≠ L77), A74 (= A78), A75 (= A79), A77 (= A81), S116 (= S120), Y143 (= Y146), K147 (= K150), V173 (≠ I176)
3ruhA Alternative analogs as viable substrates of udp-hexose 4-epimerases
34% identity, 96% coverage: 7:303/310 of query aligns to 20:324/336 of 3ruhA
- active site: S142 (= S121), S143 (≠ A122), S144 (≠ A123), Y166 (= Y146), K170 (= K150), N204 (≠ S184)
- binding nicotinamide-adenine-dinucleotide: G23 (= G10), G26 (= G13), F27 (= F14), I28 (= I15), D47 (= D34), N48 (= N35), S50 (= S37), T51 (= T38), G52 (= G39), D78 (= D57), I79 (≠ V58), Q98 (≠ L77), A99 (= A78), A100 (= A79), T117 (≠ A96), A140 (= A119), A141 (≠ S120), S142 (= S121), Y166 (= Y146), K170 (= K150), Y193 (≠ F173), V196 (≠ I176)
- binding [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl][(2R,3R,4R,5R,6R)-6-(hydroxymethyl)-4,5-bis(oxidanyl)-3-(2-oxidanylidenepropyl)oxan-2-yl] hydrogen phosphate: G102 (≠ A81), S103 (= S82), S142 (= S121), S143 (≠ A122), S144 (≠ A123), Y166 (= Y146), Y193 (≠ F173), N195 (= N175), A209 (≠ G189), V210 (= V190), K213 (≠ I193), W214 (≠ F194), Y225 (≠ T205), I226 (≠ V206), N227 (≠ F207), R234 (= R214), L271 (= L250), R294 (= R273), D297 (= D276), V298 (≠ I277), S301 (= S280)
3rufA Alternative analogs as viable substrates of udp-hexose 4-epimerases
34% identity, 96% coverage: 7:303/310 of query aligns to 20:324/336 of 3rufA
- active site: S142 (= S121), S143 (≠ A122), S144 (≠ A123), Y166 (= Y146), K170 (= K150), N204 (≠ S184)
- binding nicotinamide-adenine-dinucleotide: G23 (= G10), G26 (= G13), F27 (= F14), I28 (= I15), D47 (= D34), N48 (= N35), S50 (= S37), T51 (= T38), G52 (= G39), D78 (= D57), I79 (≠ V58), Q98 (≠ L77), A99 (= A78), A100 (= A79), T117 (≠ A96), A140 (= A119), Y166 (= Y146), K170 (= K150), Y193 (≠ F173), V196 (≠ I176)
- binding uridine-5'-diphosphate: N195 (= N175), A209 (≠ G189), V210 (= V190), K213 (≠ I193), W214 (≠ F194), Y225 (≠ T205), I226 (≠ V206), N227 (≠ F207), R234 (= R214), L271 (= L250), R294 (= R273), D297 (= D276)
3lu1A Crystal structure analysis of wbgu: a udp-galnac 4-epimerase (see paper)
34% identity, 96% coverage: 7:303/310 of query aligns to 20:324/336 of 3lu1A
- active site: S142 (= S121), S143 (≠ A122), S144 (≠ A123), Y166 (= Y146), K170 (= K150), N204 (≠ S184)
- binding glycine: Q135 (≠ T114), K187 (≠ E167)
- binding nicotinamide-adenine-dinucleotide: G23 (= G10), G26 (= G13), F27 (= F14), I28 (= I15), D47 (= D34), N48 (= N35), S50 (= S37), T51 (= T38), G52 (= G39), D78 (= D57), I79 (≠ V58), Q98 (≠ L77), A99 (= A78), A100 (= A79), A140 (= A119), A141 (≠ S120), S142 (= S121), Y166 (= Y146), K170 (= K150), Y193 (≠ F173), N195 (= N175)
- binding uridine-diphosphate-n-acetylgalactosamine: S103 (= S82), S142 (= S121), S143 (≠ A122), S144 (≠ A123), Y166 (= Y146), N195 (= N175), V210 (= V190), W214 (≠ F194), Y225 (≠ T205), I226 (≠ V206), N227 (≠ F207), R234 (= R214), L271 (= L250), R294 (= R273), D297 (= D276)
1sb9A Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4- epimerase complexed with udp-glucose (see paper)
33% identity, 96% coverage: 7:304/310 of query aligns to 19:329/340 of 1sb9A
- active site: S141 (= S121), S142 (≠ A122), S143 (≠ A123), Y165 (= Y146), K169 (= K150), N203 (≠ S184)
- binding nicotinamide-adenine-dinucleotide: G22 (= G10), G25 (= G13), F26 (= F14), I27 (= I15), D46 (= D34), N47 (= N35), F48 (≠ L36), T50 (= T38), G51 (= G39), D77 (= D57), I78 (≠ V58), Q97 (≠ L77), A99 (= A79), T116 (≠ A96), A139 (= A119), A140 (≠ S120), Y165 (= Y146), K169 (= K150), Y192 (≠ F173), N194 (= N175), V195 (≠ I176)
- binding uridine-5'-diphosphate-glucose: S141 (= S121), Y165 (= Y146), N194 (= N175), A208 (≠ G189), V209 (= V190), W213 (≠ F194), Y224 (≠ T205), I225 (≠ V206), N226 (≠ F207), L270 (= L250), R298 (= R273), D301 (= D276)
1sb8A Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4- epimerase complexed with udp-n-acetylgalactosamine (see paper)
33% identity, 96% coverage: 7:304/310 of query aligns to 20:330/341 of 1sb8A
- active site: S142 (= S121), S143 (≠ A122), S144 (≠ A123), Y166 (= Y146), K170 (= K150), N204 (≠ S184)
- binding nicotinamide-adenine-dinucleotide: G23 (= G10), G26 (= G13), F27 (= F14), I28 (= I15), D47 (= D34), N48 (= N35), F49 (≠ L36), T51 (= T38), G52 (= G39), D78 (= D57), I79 (≠ V58), Q98 (≠ L77), A100 (= A79), T117 (≠ A96), A140 (= A119), A141 (≠ S120), Y166 (= Y146), K170 (= K150), Y193 (≠ F173), N195 (= N175), V196 (≠ I176)
- binding uridine-diphosphate-n-acetylgalactosamine: S103 (= S82), S142 (= S121), S143 (≠ A122), S144 (≠ A123), Y166 (= Y146), N195 (= N175), A209 (≠ G189), V210 (= V190), W214 (≠ F194), Y225 (≠ T205), I226 (≠ V206), N227 (≠ F207), R234 (= R214), L271 (= L250), R299 (= R273), D302 (= D276), S306 (= S280)
Q7BJX9 UDP-N-acetylglucosamine 4-epimerase; UDP-GalNAc 4-epimerase; EC 5.1.3.7 from Plesiomonas shigelloides (Aeromonas shigelloides) (see 2 papers)
33% identity, 96% coverage: 7:303/310 of query aligns to 23:332/345 of Q7BJX9
- GVAGFI 26:31 (≠ GGAGFI 10:15) binding
- DNFSTG 50:55 (≠ DNLSTG 34:39) binding
- DI 81:82 (≠ DV 57:58) binding
- QAA 101:103 (≠ LAA 77:79) binding
- T120 (≠ A96) binding
- SS 145:146 (≠ SA 121:122) binding
- S147 (≠ A123) mutation to T: No effect on epimerase activity.
- Y169 (= Y146) binding
- K173 (= K150) binding
- YFN 196:198 (≠ FFN 173:175) binding
- V199 (≠ I176) binding
- VIPK 213:216 (≠ VISI 190:193) binding
- YIN 228:230 (≠ TVF 205:207) binding
- S236 (≠ T213) mutation to G: No effect on epimerase activity.
- R237 (= R214) binding
- R271 (≠ S247) mutation to G: No effect on epimerase activity.
- RSGD 302:305 (≠ RQGD 273:276) binding
- R307 (= R278) mutation to A: No effect on epimerase activity.
- H308 (= H279) mutation to A: No effect on epimerase activity.
- S309 (= S280) mutation to Y: Abolishes epimerase activity.
6bwlA X-ray structure of pal from bacillus thuringiensis (see paper)
35% identity, 90% coverage: 5:283/310 of query aligns to 2:282/313 of 6bwlA
- active site: T122 (≠ S121), C123 (≠ A122), M124 (≠ A123), Y147 (= Y146), K151 (= K150)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (= I15), D31 (= D34), N32 (= N35), L33 (= L36), N35 (≠ T38), S36 (≠ G39), D57 (= D57), I58 (≠ V58), L79 (= L77), A80 (= A78), A81 (= A79), I83 (≠ A81), M120 (≠ A119), K151 (= K150), N176 (= N175), T177 (≠ I176)
- binding uridine-5'-diphosphate: N176 (= N175), G189 (= G189), V190 (= V190), N205 (≠ T205), I206 (≠ V206), Y207 (≠ F207), Q212 (= Q212), R214 (= R214), I250 (≠ L250), E275 (≠ D276)
Q8NBZ7 UDP-glucuronic acid decarboxylase 1; UDP-glucuronate decarboxylase 1; UGD; UXS-1; hUXS; hUXS1; EC 4.1.1.35 from Homo sapiens (Human) (see 4 papers)
33% identity, 88% coverage: 5:276/310 of query aligns to 90:357/420 of Q8NBZ7
- G98 (= G13) binding
- F99 (= F14) binding
- V100 (≠ I15) binding
- D119 (= D34) binding
- N120 (= N35) binding
- F122 (≠ S37) binding
- T123 (= T38) binding
- G124 (= G39) binding
- D144 (= D57) binding
- V145 (= V58) binding
- L149 (≠ A62) binding
- Y150 (≠ V63) binding
- L159 (= L77) binding
- S161 (≠ A79) binding
- K177 (≠ Q95) binding
- T178 (≠ A96) binding
- N185 (= N103) binding
- G188 (≠ Q106) binding
- K191 (≠ L109) binding
- R192 (≠ K110) binding
- A200 (= A119) binding
- E204 (≠ A123) mutation to A: Reduced UDP-glucuronic acid decarboxylase activity.
- Y231 (= Y146) active site, Proton acceptor; binding ; mutation to F: Abolished UDP-glucuronic acid decarboxylase activity.
- K235 (= K150) binding
- R236 (≠ L151) mutation to H: Strongly reduced UDP-glucuronic acid decarboxylase activity, caused by a local unfolding of the active site that allows for a rotation of the dimer interface, leading to the formation of a homohexamer.
- Y245 (= Y160) binding
- Q248 (≠ E163) binding
- E249 (≠ H164) binding
- T261 (≠ I176) binding
- H267 (≠ D182) binding
- R272 (≠ G189) binding
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
- 361 R→Q: Strongly reduced UDP-glucuronic acid decarboxylase activity.
2b69A Crystal structure of human udp-glucoronic acid decarboxylase
33% identity, 88% coverage: 5:276/310 of query aligns to 3:270/312 of 2b69A
- active site: T115 (≠ S121), S116 (≠ A122), E117 (≠ A123), Y144 (= Y146), K148 (= K150), R185 (≠ G189)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), F12 (= F14), V13 (≠ I15), D32 (= D34), N33 (= N35), T36 (= T38), G37 (= G39), D57 (= D57), V58 (= V58), L72 (= L77), A73 (= A78), S74 (≠ A79), A76 (= A81), T91 (≠ A96), T115 (≠ S121), Y144 (= Y146), K148 (= K150), I171 (≠ F173), N173 (= N175), R185 (≠ G189)
- binding uridine-5'-diphosphate: P61 (≠ S61), L62 (≠ A62), Y63 (≠ V63), P78 (≠ V83), N98 (= N103), G101 (≠ Q106), L102 (≠ S107), K104 (≠ L109), R105 (≠ K110), Y158 (= Y160), N173 (= N175), R185 (≠ G189), V186 (= V190), N189 (≠ I193), T201 (= T205), Y203 (≠ F207), Q208 (= Q212), R210 (= R214), I244 (≠ L250), D270 (= D276)
8vr2B Crystal structure of the pcryo_0617 oxidoreductase/decarboxylase from psychrobacter cryohalolentis k5 in the presence of NAD and udp
35% identity, 79% coverage: 5:249/310 of query aligns to 9:249/321 of 8vr2B
- binding nicotinamide-adenine-dinucleotide: G14 (= G10), G17 (= G13), F18 (= F14), I19 (= I15), D37 (= D34), N38 (= N35), E40 (≠ S37), R41 (≠ T38), N61 (≠ D57), V62 (= V58), A81 (≠ L77), A82 (= A78), A83 (= A79), F124 (≠ A119), K154 (= K150), P177 (≠ F173), N179 (= N175)
- binding uridine-5'-diphosphate: R147 (≠ L143), G189 (= G189), A190 (≠ V190), M194 (≠ F194), Y205 (≠ T205), I206 (≠ V206), F207 (= F207), R214 (= R214)
Sites not aligning to the query:
6pmhA Structure of epimerase mth375 from the thermophilic pseudomurein- containing methanogen methanothermobacter thermautotrophicus
34% identity, 91% coverage: 6:288/310 of query aligns to 12:288/330 of 6pmhA
- active site: S127 (= S121), C129 (≠ A123), G130 (vs. gap), Y153 (= Y146), K157 (= K150)
- binding adenosine monophosphate: G16 (= G10), G19 (= G13), D40 (= D34), N41 (= N35), S43 (= S37), S44 (≠ T38), S45 (≠ G39), D62 (= D57), I63 (≠ V58), A84 (= A78), F87 (≠ A81), R194 (≠ S188)
- binding uridine-5'-diphosphate: C129 (≠ A123), N182 (= N175), N195 (≠ G189), V196 (= V190), F200 (= F194), P211 (≠ T205), I212 (≠ V206), T213 (≠ F207), R220 (= R214), V256 (≠ L250), R279 (= R273)
6pnlA Structure of epimerase mth375 from the thermophilic pseudomurein- containing methanogen methanothermobacter thermautotrophicus
34% identity, 91% coverage: 6:288/310 of query aligns to 18:294/336 of 6pnlA
- active site: S133 (= S121), C135 (≠ A123), G136 (vs. gap), Y159 (= Y146), K163 (= K150)
- binding nicotinamide-adenine-dinucleotide: G22 (= G10), G25 (= G13), C26 (≠ F14), D46 (= D34), N47 (= N35), L48 (= L36), S49 (= S37), S50 (≠ T38), S51 (≠ G39), D68 (= D57), I69 (≠ V58), L89 (= L77), A91 (= A79), F93 (≠ A81), V108 (≠ A96), S131 (≠ A119), S133 (= S121), Y159 (= Y146), K163 (= K150), F186 (= F173), N188 (= N175), V189 (≠ I176), R200 (≠ S188)
- binding uridine-5'-diphosphate: N188 (= N175), N201 (≠ G189), V202 (= V190), F206 (= F194), P217 (≠ T205), I218 (≠ V206), T219 (≠ F207), R226 (= R214), V262 (≠ L250), R285 (= R273)
6zllA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-galacturonic acid and NAD (see paper)
30% identity, 96% coverage: 5:303/310 of query aligns to 2:303/321 of 6zllA
- active site: T126 (≠ S121), S127 (≠ A122), S128 (≠ A123), Y149 (= Y146), K153 (= K150)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (= I15), D32 (= D34), H33 (≠ N35), F34 (vs. gap), I35 (vs. gap), K43 (≠ S37), D62 (= D57), I63 (≠ V58), L81 (= L77), A82 (= A78), A83 (= A79), I124 (≠ A119), T126 (≠ S121), Y149 (= Y146), K153 (= K150), Y176 (≠ F173), V179 (≠ I176), R185 (≠ D182), M188 (≠ S185)
- binding (2S,3R,4S,5R,6R)-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4,5-trihydroxy-oxane-2-carboxylic acid: P85 (≠ A81), V87 (= V83), R88 (≠ Q84), T126 (≠ S121), S127 (≠ A122), Y149 (= Y146), T178 (≠ N175), R185 (≠ D182), A189 (≠ P186), R192 (≠ G189), T204 (= T205), F206 (= F207), Q211 (= Q212), R213 (= R214), I250 (≠ L250), E276 (≠ D276)
6zldA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-glucuronic acid and NAD (see paper)
30% identity, 96% coverage: 5:303/310 of query aligns to 2:303/314 of 6zldA
- active site: T126 (≠ S121), S127 (≠ A122), S128 (≠ A123), Y149 (= Y146), K153 (= K150)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (= I15), D32 (= D34), H33 (≠ N35), F34 (vs. gap), I35 (vs. gap), K43 (≠ S37), D62 (= D57), I63 (≠ V58), L81 (= L77), A82 (= A78), A83 (= A79), I124 (≠ A119), T126 (≠ S121), K153 (= K150), Y176 (≠ F173), T178 (≠ N175), R185 (≠ D182), M188 (≠ S185)
- binding uridine-5'-diphosphate-glucuronic acid: P85 (≠ A81), R88 (≠ Q84), T126 (≠ S121), S127 (≠ A122), S128 (≠ A123), Y149 (= Y146), F177 (= F174), T178 (≠ N175), R185 (≠ D182), M188 (≠ S185), A189 (≠ P186), R192 (≠ G189), T204 (= T205), F206 (= F207), Q211 (= Q212), R213 (= R214), I250 (≠ L250), E276 (≠ D276)
6zl6A Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp and NAD (see paper)
30% identity, 96% coverage: 5:303/310 of query aligns to 2:303/314 of 6zl6A
- active site: T126 (≠ S121), S127 (≠ A122), S128 (≠ A123), Y149 (= Y146), K153 (= K150)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (= I15), D32 (= D34), H33 (≠ N35), F34 (vs. gap), I35 (vs. gap), K43 (≠ S37), D62 (= D57), I63 (≠ V58), L81 (= L77), A82 (= A78), A83 (= A79), I124 (≠ A119), T126 (≠ S121), K153 (= K150), Y176 (≠ F173), T178 (≠ N175), V179 (≠ I176), R185 (≠ D182), M188 (≠ S185)
- binding uridine-5'-diphosphate: T178 (≠ N175), A189 (≠ P186), R192 (≠ G189), T204 (= T205), F206 (= F207), Q211 (= Q212), R213 (= R214), I250 (≠ L250), E276 (≠ D276)
Query Sequence
>GFF272 FitnessBrowser__WCS417:GFF272
MAVGRILVTGGAGFIGSHLVEALLGKGYKIRVLDNLSTGKVANLPVAHPDLELMIGDVAD
SAVVEQAMADCSAVVHLAAVASVQASVDDPVATHQANFVGTLNVCQSMLKAGVTRVVFAS
SAATYGNNGEGTAIAEDTPKSPLTPYASDKLASEYYLDFYRREHGLEPVIFRFFNIFGPR
QDPSSPYSGVISIFTERALAGKPITVFGDGEQTRDFVYVQDLVSILVQAVETREPAPEAI
NVGLSRSTSLNDLIAELGNATGTALNVTYQAPRQGDIRHSRANNTRLLERFALPQPTSIG
QGLAQLLRSL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory