Comparing GFF273 FitnessBrowser__Marino:GFF273 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
3n2oA X-ray crystal structure of arginine decarboxylase complexed with arginine from vibrio vulnificus (see paper)
55% identity, 98% coverage: 13:636/636 of query aligns to 9:630/630 of 3n2oA
3n2oB X-ray crystal structure of arginine decarboxylase complexed with arginine from vibrio vulnificus (see paper)
55% identity, 98% coverage: 13:636/636 of query aligns to 8:629/629 of 3n2oB
3nzqA Crystal structure of biosynthetic arginine decarboxylase adc (spea) from escherichia coli, northeast structural genomics consortium target er600 (see paper)
54% identity, 98% coverage: 11:636/636 of query aligns to 4:624/628 of 3nzqA
Q9SI64 Arginine decarboxylase 1, chloroplastic; ADC 1; ADC-O; ARGDC 1; AtADC1; EC 4.1.1.19 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 94% coverage: 5:604/636 of query aligns to 35:623/702 of Q9SI64
3nzpB Crystal structure of the biosynthetic arginine decarboxylase spea from campylobacter jejuni, northeast structural genomics consortium target br53 (see paper)
33% identity, 98% coverage: 13:635/636 of query aligns to 4:579/591 of 3nzpB
B4XMC6 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Helicobacter pylori (Campylobacter pylori) (see paper)
26% identity, 46% coverage: 70:364/636 of query aligns to 17:284/405 of B4XMC6
Sites not aligning to the query:
3c5qA Crystal structure of diaminopimelate decarboxylase (i148l mutant) from helicobacter pylori complexed with l-lysine
25% identity, 45% coverage: 70:356/636 of query aligns to 15:274/394 of 3c5qA
Sites not aligning to the query:
1twiA Crystal structure of diaminopimelate decarboxylase from m. Jannaschii in co-complex with l-lysine (see paper)
26% identity, 48% coverage: 75:382/636 of query aligns to 45:329/434 of 1twiA
Sites not aligning to the query:
1tufA Crystal structure of diaminopimelate decarboxylase from m. Jannaschi (see paper)
26% identity, 48% coverage: 75:382/636 of query aligns to 45:329/434 of 1tufA
Sites not aligning to the query:
Q58497 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
26% identity, 48% coverage: 75:382/636 of query aligns to 49:333/438 of Q58497
Sites not aligning to the query:
4xg1B Psychromonas ingrahamii diaminopimelate decarboxylase with llp
29% identity, 43% coverage: 80:355/636 of query aligns to 43:289/418 of 4xg1B
Sites not aligning to the query:
6n2aA Meso-diaminopimelate decarboxylase from arabidopsis thaliana (isoform 1)
25% identity, 43% coverage: 82:355/636 of query aligns to 43:294/422 of 6n2aA
Sites not aligning to the query:
1hkvA Mycobacterium diaminopimelate dicarboxylase (lysa) (see paper)
25% identity, 48% coverage: 49:355/636 of query aligns to 30:315/446 of 1hkvA
Sites not aligning to the query:
P9WIU7 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
25% identity, 48% coverage: 49:355/636 of query aligns to 31:316/447 of P9WIU7
Sites not aligning to the query:
5x7mA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
25% identity, 49% coverage: 42:355/636 of query aligns to 28:313/443 of 5x7mA
Sites not aligning to the query:
5x7nA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
25% identity, 49% coverage: 42:355/636 of query aligns to 28:313/442 of 5x7nA
Sites not aligning to the query:
2pljA Crystal structure of lysine/ornithine decarboxylase complexed with putrescine from vibrio vulnificus (see paper)
34% identity, 12% coverage: 221:296/636 of query aligns to 151:225/376 of 2pljA
Sites not aligning to the query:
4xg1A Psychromonas ingrahamii diaminopimelate decarboxylase with llp
27% identity, 36% coverage: 125:355/636 of query aligns to 72:262/393 of 4xg1A
Sites not aligning to the query:
2plkA Crystal structure of lysine/ornithine decarboxylase complexed with cadaverine from vibrio vulnificus (see paper)
34% identity, 12% coverage: 221:296/636 of query aligns to 146:220/370 of 2plkA
Sites not aligning to the query:
>GFF273 FitnessBrowser__Marino:GFF273
MSEASATPAHKVYNIAHWSDGYIGVNDQGQVLIRPDRGHSPARINLPELTRTLTESGVQL
PVLVRFVDILHDRVNKLCNAFNKVAEEHAYQGGYTAVYPIKVNQQRRVVEELLAAEPAAS
NGQIGLEAGSKPELMAVLAMSQQPGSVIVCNGYKDREYIRLALIGQTLGHRVFIVVEKKS
ELPLILEEAKSLGVSPLIGVRARLATIGKGNWQNTGGEKSKFGLSASQVLDVVDTLREAG
ALDTLQLLHFHLGSQIANIRDIQTGLRECARFYSELRQMGAPIGTVDIGGGLGVDYEGTR
SRSSCSMNYSVYEYAYNVVHVLQAECDRHGTPHPDLISESGRALTAHHSVLVTNVIDHEA
PENRTPQQPGATASAPLHDLWRDLESLQDTNTPRSLAEIYHDVLHAMADVHAQFAHGVLS
LQERADAETLYTRCCRLLRDQLDSSNRAHREIIDELNEKLAEKLFVNFSLFQSLPDVWGI
DQIFPVMPINGLDRPLNRRAVIQDITCDSDGRIDRYVDGQGTETTLPLPEERSGEPLLMG
FFMTGAYQEILGDMHNLFGDTHSVDVRLTPEGGYEISAPITGDTVAKVLRYVNFEPEALM
EAYRGKFAASALAAETQAALMAELAAGLDGYTYLEE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory