Comparing GFF2730 FitnessBrowser__psRCH2:GFF2730 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0ADG4 Nus factor SuhB; Inositol-1-monophosphatase; I-1-Pase; IMPase; Inositol-1-phosphatase; EC 3.1.3.25 from Escherichia coli (strain K12) (see 5 papers)
36% identity, 88% coverage: 17:250/267 of query aligns to 12:252/267 of P0ADG4
Sites not aligning to the query:
6ib8B Structure of a complex of suhb and nusa ar2 domain (see paper)
36% identity, 88% coverage: 17:250/267 of query aligns to 16:256/270 of 6ib8B
2qflA Structure of suhb: inositol monophosphatase and extragenic suppressor from e. Coli (see paper)
36% identity, 88% coverage: 17:250/267 of query aligns to 12:252/262 of 2qflA
6tqoT Rrn anti-termination complex (see paper)
37% identity, 80% coverage: 37:250/267 of query aligns to 22:244/255 of 6tqoT
Q9M8S8 Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Myo-inositol monophosphatase; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 76% coverage: 32:233/267 of query aligns to 31:238/271 of Q9M8S8
3lv0A Crystal structure of extragenic suppressor protein suhb from bartonella henselae, native
35% identity, 87% coverage: 17:247/267 of query aligns to 11:246/258 of 3lv0A
5dw8A Crystal structure of 2'amp bound saimpase-ii
32% identity, 89% coverage: 30:267/267 of query aligns to 12:252/260 of 5dw8A
5j16A Crystal structure of inositol monophosphate bound saimpase-ii
34% identity, 82% coverage: 50:267/267 of query aligns to 28:248/258 of 5j16A
3luzB Crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement (see paper)
35% identity, 77% coverage: 42:247/267 of query aligns to 23:224/234 of 3luzB
Sites not aligning to the query:
3luzA Crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement (see paper)
35% identity, 76% coverage: 44:247/267 of query aligns to 24:228/238 of 3luzA
Sites not aligning to the query:
O14732 Inositol monophosphatase 2; IMP 2; IMPase 2; Inositol-1(or 4)-monophosphatase 2; Myo-inositol monophosphatase A2; EC 3.1.3.25 from Homo sapiens (Human) (see 2 papers)
33% identity, 84% coverage: 10:233/267 of query aligns to 20:248/288 of O14732
2cziA Crystal structure of human myo-inositol monophosphatase 2 (impa2) with calcium and phosphate ions (see paper)
34% identity, 84% coverage: 10:233/267 of query aligns to 6:225/259 of 2cziA
2p3nA Thermotoga maritima impase tm1415 (see paper)
32% identity, 75% coverage: 34:234/267 of query aligns to 25:219/256 of 2p3nA
O33832 Fructose-1,6-bisphosphatase/inositol-1-monophosphatase; FBPase/IMPase; Inositol-1-phosphatase; I-1-Pase; EC 3.1.3.11; EC 3.1.3.25 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
32% identity, 75% coverage: 34:234/267 of query aligns to 25:219/256 of O33832
4as5A Structure of mouse inositol monophosphatase 1 (see paper)
31% identity, 76% coverage: 31:233/267 of query aligns to 26:235/274 of 4as5A
2bjiA High resolution structure of myo-inositol monophosphatase, the target of lithium therapy (see paper)
30% identity, 83% coverage: 13:233/267 of query aligns to 10:235/274 of 2bjiA
P20456 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Bos taurus (Bovine) (see paper)
30% identity, 83% coverage: 13:233/267 of query aligns to 12:237/277 of P20456
O55023 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Mus musculus (Mouse) (see paper)
31% identity, 76% coverage: 31:233/267 of query aligns to 28:237/277 of O55023
P9WKI9 Inositol-1-monophosphatase SuhB; I-1-Pase; IMPase; Inositol-1-phosphatase; EC 3.1.3.25 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
36% identity, 66% coverage: 41:217/267 of query aligns to 50:236/290 of P9WKI9
1imdA Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis (see paper)
29% identity, 72% coverage: 41:233/267 of query aligns to 33:233/266 of 1imdA
>GFF2730 FitnessBrowser__psRCH2:GFF2730
MSNLDIDARYACAKSLALEAAQLGMDYYRQRETLDVEHKGSDQQDVVSIADKSIEDFIRA
RLAEQFPQDGFLGEESGSADLKARCVWVIDPIDGTACFVNGLHNWCVSIGLLIDGEPHIG
AIADPNHDELFHGCVGRGAYVNQTRLKASAATHVREGLTGAGTFHPRGKEHFIPFLEKLL
AEGGMFIRNGSGALMTAYVAAGRLIGYYETELKSWDCLAGLVLVAEAGALRNDFFRDDGL
LRGNPYLVAAPGVYRQLSELIGPSLDA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory