SitesBLAST
Comparing GFF2732 HP15_2676 proton/sodium-glutamate symport protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
37% identity, 96% coverage: 8:414/426 of query aligns to 15:418/425 of O59010
- S65 (= S64) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ S277) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ SSS 277:279) binding
- M311 (= M313) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (= T316) binding
- V355 (≠ T357) binding
- D394 (= D390) binding
- M395 (= M391) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R393) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N397) binding
- D405 (= D401) mutation to N: Strongly decreased affinity for aspartate.
2nwwA Crystal structure of gltph in complex with tboa (see paper)
38% identity, 93% coverage: 8:402/426 of query aligns to 6:397/407 of 2nwwA
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
37% identity, 95% coverage: 8:413/426 of query aligns to 15:417/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ P45), F46 (≠ P45), P75 (≠ L75), L91 (≠ I91), F95 (≠ M95), L130 (= L138), I133 (≠ T141), I159 (= I167), Y167 (vs. gap), K196 (≠ T197), G200 (≠ W201), I207 (= I208), F210 (= F211), L250 (≠ I250), I262 (≠ L263), M269 (≠ L270), T334 (≠ S336), V335 (≠ M337), G336 (= G338), T340 (≠ L342), L343 (≠ A345), M399 (≠ A395)
- binding aspartic acid: S277 (= S278), S278 (= S279), T314 (= T316), G354 (≠ A356), A358 (≠ V360), G359 (= G361), D394 (= D390), R397 (= R393), T398 (= T394)
- binding sodium ion: Y89 (≠ F89), T92 (= T92), S93 (≠ T93), G306 (= G308), T308 (= T310), N310 (= N312), N310 (= N312), M311 (= M313), D312 (≠ N314), S349 (= S351), I350 (= I352), T352 (≠ S354), N401 (= N397), V402 (= V398), D405 (= D401)
Sites not aligning to the query:
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
37% identity, 95% coverage: 8:413/426 of query aligns to 7:409/409 of 6bavA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
38% identity, 93% coverage: 8:402/426 of query aligns to 7:398/408 of 6bauA
- binding cysteine: S270 (= S279), M303 (= M313), T306 (= T316), A345 (≠ P355), G346 (≠ A356), V347 (≠ T357), G351 (= G361), D386 (= D390), C389 (≠ R393), T390 (= T394), N393 (= N397)
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
38% identity, 93% coverage: 8:402/426 of query aligns to 12:403/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G68), V83 (≠ T86), I157 (= I168), Y164 (vs. gap), K193 (≠ T197), T305 (= T310), I306 (= I311), I347 (= I352)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (≠ V9), M199 (= M203), S275 (= S279), T311 (= T316), G356 (= G361), L384 (≠ M383), D391 (= D390), R394 (= R393)
Sites not aligning to the query:
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
36% identity, 93% coverage: 5:402/426 of query aligns to 11:406/427 of 5e9sA
- binding aspartic acid: R274 (≠ S277), S275 (= S278), S276 (= S279), T313 (= T316), G353 (≠ A356), V354 (≠ T357), A357 (≠ V360), G358 (= G361), D394 (= D390), R397 (= R393), T398 (= T394)
- binding decyl-beta-d-maltopyranoside: L194 (≠ T197), G198 (≠ W201), Y202 (≠ L205)
- binding sodium ion: Y87 (≠ F89), T90 (= T92), S91 (≠ T93), S276 (= S279), G305 (= G308), A306 (= A309), T307 (= T310), N309 (= N312), N309 (= N312), M310 (= M313), D311 (≠ N314), S348 (= S351), I349 (= I352), G350 (= G353), T351 (≠ S354), N401 (= N397), V402 (= V398), D405 (= D401)
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
36% identity, 93% coverage: 5:402/426 of query aligns to 11:406/426 of 6xwnB
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
36% identity, 93% coverage: 5:402/426 of query aligns to 8:403/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ T197), G195 (≠ W201), R282 (= R288)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ S277), S272 (= S278), S273 (= S279), M307 (= M313), T310 (= T316), G353 (= G359), A354 (≠ V360), R394 (= R393), T395 (= T394)
Sites not aligning to the query:
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
36% identity, 93% coverage: 5:402/426 of query aligns to 4:395/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ S277), S265 (= S279), M299 (= M313), T302 (= T316), T340 (≠ S354), G342 (≠ A356), V343 (≠ T357), G347 (= G361), D383 (= D390), R386 (= R393), T387 (= T394), N390 (= N397)
- binding decyl-beta-d-maltopyranoside: H23 (≠ E31), V212 (≠ M226), A216 (= A230)
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
36% identity, 93% coverage: 5:402/426 of query aligns to 9:404/425 of 6zgbA
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
36% identity, 93% coverage: 8:402/426 of query aligns to 7:386/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
34% identity, 89% coverage: 40:419/426 of query aligns to 51:409/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ L78), G89 (≠ R79), G92 (= G82), A95 (≠ V85), V96 (≠ T86), Y99 (≠ F89), M163 (≠ I167), F167 (≠ I171), F293 (= F303), V297 (≠ L307)
- binding aspartic acid: S268 (= S278), S269 (= S279), T306 (= T316), G346 (≠ A356), I347 (≠ T357), A350 (≠ V360), G351 (= G361), D380 (= D390), R383 (= R393), T384 (= T394)
O35874 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Mus musculus (Mouse) (see 2 papers)
31% identity, 88% coverage: 41:414/426 of query aligns to 74:480/532 of O35874
- N201 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
33% identity, 89% coverage: 40:419/426 of query aligns to 43:395/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (= L69), S80 (≠ L78), G81 (≠ R79), G84 (= G82), Y91 (≠ F89), M156 (≠ I167), F160 (≠ I171), F286 (= F303), V290 (≠ L307)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (≠ V61), I148 (≠ M159), S262 (= S279), S263 (≠ A280), A292 (= A309), T293 (= T310), M296 (= M313), T299 (= T316), G329 (= G353), A336 (≠ V360), G337 (= G361), D366 (= D390), R369 (= R393), N373 (= N397)
P56564 Excitatory amino acid transporter 1; Glial high affinity glutamate transporter; High-affinity neuronal glutamate transporter; GluT-1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Mus musculus (Mouse) (see paper)
31% identity, 90% coverage: 40:421/426 of query aligns to 79:507/543 of P56564
- N206 (≠ P139) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N216 (= N149) modified: carbohydrate, N-linked (GlcNAc...) asparagine
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
30% identity, 85% coverage: 41:401/426 of query aligns to 51:449/503 of Q10901
- N177 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N187 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
P43003 Excitatory amino acid transporter 1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Homo sapiens (Human) (see 3 papers)
32% identity, 90% coverage: 40:421/426 of query aligns to 79:507/542 of P43003
- S363 (= S277) mutation to R: Loss of electrogenic glutamate transport. Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with M-477.
- SSS 363:365 (= SSS 277:279) binding
- T396 (= T310) binding
- T402 (= T316) binding
- IPQAG 443:447 (≠ TPGVG 357:361) binding
- D476 (= D390) binding
- R477 (≠ M391) mutation to M: Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with R-363.
- N483 (= N397) binding
Sites not aligning to the query:
- 523 Y→F: No effect on activity.
8cv2A Human excitatory amino acid transporter 3 (eaat3) in an outward facing sodium-bound state (see paper)
32% identity, 96% coverage: 15:422/426 of query aligns to 17:433/433 of 8cv2A
- binding sodium ion: Y85 (≠ F89), T88 (= T92), T89 (= T93), G319 (= G308), A320 (= A309), N323 (= N312), N323 (= N312), M324 (= M313), D325 (≠ N314), N408 (= N397), D412 (= D401)
P31596 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; GLUT-R; Solute carrier family 1 member 2 from Rattus norvegicus (Rat) (see paper)
30% identity, 92% coverage: 10:401/426 of query aligns to 51:485/573 of P31596
- K298 (≠ L217) mutation K->H,R: Normal transporter activity.; mutation K->N,T: Reduced transporter activity.
- H326 (≠ L243) mutation H->N,T,K,R: No transporter activity.
Query Sequence
>GFF2732 HP15_2676 proton/sodium-glutamate symport protein
MQGKLWLKVLIGMFLGLITGTLLGPSVGLVEPETGTLIGNWLAFPGQLFLATIQMIVIPL
VIASVVRGLAAGEDLEQLRKLGLRVTGFFVITTAMAASIGLWIGDLINPGRMMAGLGTPV
AAGENSVPVASMPGVDELPKTLIGLLPGNPLDAMVEGQMLQVVIFSIIVGIALVSMAPEK
SRPMLDLLDSLQQICMTVVRWAMRLAPIAVFGLMAQLTTTLGFRAMLGMASYVATVIAGL
LVLLGVYMLILKLLAGQSPVRFLKDTRDVLLLAFSTSSSAAVMPLSIRTAEDKLGVRPSV
SQFVIPLGATINMNGTALYQAVATIFLAQVYGIDLSMGSMALVVAMAVGASIGSPATPGV
GIVILAMVLQTVGIPPSGIALIMGVDRILDMCRTAINVTGDLVTCRLMENLAGKRLPPEP
VPEETS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory