Comparing GFF2734 FitnessBrowser__WCS417:GFF2734 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2vi7C Structure of a putative acetyltransferase (pa1377)from pseudomonas aeruginosa (see paper)
68% identity, 95% coverage: 6:167/170 of query aligns to 2:164/165 of 2vi7C
2ge3A Crystal structure of probable acetyltransferase from agrobacterium tumefaciens
40% identity, 75% coverage: 38:164/170 of query aligns to 37:160/164 of 2ge3A
Sites not aligning to the query:
P0A951 Spermidine N(1)-acetyltransferase; SAT; Spermidine/spermine N(1)-acetyltransferase; SSAT; EC 2.3.1.57 from Escherichia coli (strain K12) (see 4 papers)
29% identity, 95% coverage: 4:164/170 of query aligns to 2:163/186 of P0A951
Sites not aligning to the query:
3wr7A Crystal structure of spermidine acetyltransferase from escherichia coli (see paper)
29% identity, 86% coverage: 18:164/170 of query aligns to 13:159/170 of 3wr7A
2i79A The crystal structure of the acetyltransferase of gnat family from streptococcus pneumoniae
31% identity, 76% coverage: 37:166/170 of query aligns to 41:170/171 of 2i79A
Sites not aligning to the query:
4r9mA Crystal structure of spermidine n-acetyltransferase from escherichia coli (see paper)
27% identity, 95% coverage: 4:164/170 of query aligns to 2:160/169 of 4r9mA
6e1xA Crystal structure of product-bound complex of spermidine/spermine n- acetyltransferase speg
28% identity, 89% coverage: 18:169/170 of query aligns to 14:166/170 of 6e1xA
4r87A Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with coa and spermine (see paper)
28% identity, 89% coverage: 18:169/170 of query aligns to 14:166/170 of 4r87A
4r57A Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with acetyl-coa (see paper)
28% identity, 89% coverage: 18:169/170 of query aligns to 14:166/170 of 4r57A
4nczA Spermidine n-acetyltransferase from vibrio cholerae in complex with 2- [n-cyclohexylamino]ethane sulfonate. (see paper)
28% identity, 89% coverage: 18:169/170 of query aligns to 14:166/170 of 4nczA
4mi4A Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with spermine (see paper)
28% identity, 89% coverage: 18:169/170 of query aligns to 14:166/170 of 4mi4A
4mhdA Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with spermidine (see paper)
28% identity, 89% coverage: 18:169/170 of query aligns to 14:166/170 of 4mhdA
6cx8A Crystal structure of spermidine/spermine n-acetyltransferase speg from vibrio cholerae in complex with manganese ions.
28% identity, 89% coverage: 18:169/170 of query aligns to 15:167/173 of 6cx8A
5cnpB X-ray crystal structure of spermidine n1-acetyltransferase from vibrio cholerae. (see paper)
28% identity, 89% coverage: 18:169/170 of query aligns to 14:166/171 of 5cnpB
Q9KL03 Spermidine N(1)-acetyltransferase; SAT; Spermidine/spermine N(1)-acetyltransferase; SSAT; EC 2.3.1.57 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) (see 2 papers)
28% identity, 89% coverage: 18:169/170 of query aligns to 15:167/173 of Q9KL03
6e1xC Crystal structure of product-bound complex of spermidine/spermine n- acetyltransferase speg
28% identity, 89% coverage: 18:169/170 of query aligns to 18:170/176 of 6e1xC
P0A948 [Ribosomal protein uS5]-alanine N-acetyltransferase; Acetylating enzyme for N-terminal of ribosomal protein S5; EC 2.3.1.267 from Escherichia coli (strain K12) (see paper)
30% identity, 72% coverage: 43:164/170 of query aligns to 57:184/194 of P0A948
Sites not aligning to the query:
6vfnA Crystal structure of speg allosteric polyamine acetyltransferase from bacillus thuringiensis in complex with spermine (see paper)
23% identity, 89% coverage: 18:168/170 of query aligns to 12:162/167 of 6vfnA
6d72B Crystal structure of spermidine/spermine n-acetyltransferase speg from yersinia pestis in complex with calcium ions.
25% identity, 86% coverage: 18:164/170 of query aligns to 18:164/176 of 6d72B
6yzzA Arabidopsis thaliana naa50 in complex with accoa (see paper)
34% identity, 38% coverage: 89:153/170 of query aligns to 75:138/151 of 6yzzA
>GFF2734 FitnessBrowser__WCS417:GFF2734
MHTPEPHIVIQRFTEAHLEGVAALYNEPAVCRQVLQMPFQSVEAWRNKLVQDNERRLQLV
AVHGGEVIGQLGLEQYLRVRRAHVGSFGMGVATAWQGKGVGSRLLTAALDVADNWMNLRR
VELTVYADNDAAQALYRKFGFEVEGVLRDYALRDGQFVDTVSMARLRTSV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory