SitesBLAST
Comparing GFF2734 FitnessBrowser__psRCH2:GFF2734 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zqbB Crystal structure of NADP-dependent dehydrogenase from rhodobactersphaeroides in complex with NADP and sulfate
42% identity, 95% coverage: 17:310/310 of query aligns to 21:316/316 of 4zqbB
- active site: L99 (≠ M93), R231 (= R225), E260 (= E254), H279 (= H273)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R93 (= R87), M103 (= M97), G147 (= G141), L148 (≠ T142), G149 (= G143), E150 (≠ Q144), L151 (≠ M145), W169 (= W163), S170 (≠ N164), R171 (≠ L165), S172 (≠ R166), K174 (≠ G168), L202 (= L196), P203 (= P197), F229 (≠ L223), R231 (= R225), H279 (= H273), S281 (≠ A275), A282 (= A276), Y316 (= Y310)
5vg6B Crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from xanthobacter autotrophicus py2 in complex with NADPH and mes.
40% identity, 95% coverage: 17:310/310 of query aligns to 17:315/315 of 5vg6B
- active site: M98 (= M93), R230 (= R225), D254 (= D249), E259 (= E254), H278 (= H273)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A74 (= A69), R92 (= R87), M102 (= M97), L147 (≠ T142), G148 (= G143), D149 (≠ Q144), L150 (≠ M145), W168 (= W163), S169 (≠ N164), R170 (≠ L165), T171 (≠ R166), K173 (≠ G168), L201 (= L196), P202 (= P197), T207 (= T202), V228 (≠ L223), R230 (= R225), H278 (= H273), A280 (= A275), S281 (≠ A276), Y315 (= Y310)
7jqiA Structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with alpha-ketoglutarate and NADP+
35% identity, 100% coverage: 1:310/310 of query aligns to 1:312/312 of 7jqiA
- binding 2-oxoglutaric acid: G64 (≠ W68), A65 (= A69), G66 (= G70), R227 (= R225), H275 (= H273)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A65 (= A69), R89 (= R87), M99 (= M97), A144 (≠ T142), G145 (= G143), V146 (≠ Q144), L147 (≠ M145), W165 (= W163), S166 (≠ N164), R167 (≠ L165), T168 (≠ R166), K170 (≠ G168), L198 (= L196), P199 (= P197), L225 (= L223), R227 (= R225), H275 (= H273), A278 (= A276), Y312 (= Y310)
7jqhA Structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with phosphate and NADP+
35% identity, 100% coverage: 1:310/310 of query aligns to 2:313/313 of 7jqhA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A66 (= A69), R90 (= R87), M100 (= M97), A145 (≠ T142), G146 (= G143), V147 (≠ Q144), L148 (≠ M145), W166 (= W163), S167 (≠ N164), R168 (≠ L165), T169 (≠ R166), K171 (≠ G168), L199 (= L196), P200 (= P197), L226 (= L223), A227 (= A224), R228 (= R225), D252 (= D249), H276 (= H273), A279 (= A276), Y313 (= Y310)
6p35A 2.5 angstrom structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with 2-keto arginine and NADP
35% identity, 100% coverage: 1:310/310 of query aligns to 1:312/312 of 6p35A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A65 (= A69), R89 (= R87), M99 (= M97), A144 (≠ T142), G145 (= G143), V146 (≠ Q144), L147 (≠ M145), W165 (= W163), S166 (≠ N164), R167 (≠ L165), T168 (≠ R166), K170 (≠ G168), L198 (= L196), P199 (= P197), L225 (= L223), R227 (= R225), H275 (= H273), A277 (= A275), A278 (= A276), Y312 (= Y310)
- binding 5-[(diaminomethylidene)amino]-2-oxopentanoic acid: F10 (≠ D10), D11 (= D11), W15 (= W17), A65 (= A69), R227 (= R225), H275 (= H273), T280 (= T278)
4z0pA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
37% identity, 87% coverage: 42:310/310 of query aligns to 44:316/316 of 4z0pA
- active site: L95 (≠ M93), R231 (= R225), G250 (≠ S244), D255 (= D249), E260 (= E254), H279 (= H273)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R89 (= R87), M99 (= M97), M144 (≠ T142), G145 (= G143), V146 (≠ Q144), L147 (≠ M145), W165 (= W163), S166 (≠ N164), R167 (≠ L165), S168 (≠ R166), R170 (≠ G168), L197 (= L196), P198 (= P197), A229 (≠ L223), G230 (≠ A224), R231 (= R225), H279 (= H273), A281 (= A275), A282 (= A276), Y316 (= Y310)
- binding oxalic acid: W50 (≠ A48), G70 (≠ W68), A71 (= A69), G72 (= G70), H114 (= H109), R115 (= R110), R231 (= R225), H279 (= H273)
4weqA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in complex with NADP and sulfate (see paper)
37% identity, 87% coverage: 42:310/310 of query aligns to 44:316/316 of 4weqA
- active site: L95 (≠ M93), R231 (= R225), G250 (≠ S244), D255 (= D249), E260 (= E254), H279 (= H273)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R89 (= R87), M99 (= M97), M144 (≠ T142), G145 (= G143), V146 (≠ Q144), L147 (≠ M145), W165 (= W163), S166 (≠ N164), R167 (≠ L165), S168 (≠ R166), R170 (≠ G168), L197 (= L196), P198 (= P197), A229 (≠ L223), G230 (≠ A224), R231 (= R225), D255 (= D249), H279 (= H273), A281 (= A275), Y316 (= Y310)
3kboA 2.14 angstrom crystal structure of putative oxidoreductase (ycdw) from salmonella typhimurium in complex with NADP
35% identity, 95% coverage: 17:310/310 of query aligns to 15:312/312 of 3kboA
- active site: M95 (= M93), R227 (= R225), E256 (= E254), H275 (= H273)
- binding N-(2-hydroxyethyl)-N,N-dimethyl-3-sulfopropan-1-aminium: N36 (= N38), A53 (≠ Q56), R55 (≠ L58), R56 (≠ N60)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R89 (= R87), M99 (= M97), G143 (= G141), A144 (≠ T142), G145 (= G143), V146 (≠ Q144), L147 (≠ M145), W165 (= W163), S166 (≠ N164), R167 (≠ L165), S168 (≠ R166), K170 (≠ G168), L197 (= L195), P199 (= P197), L225 (= L223), A226 (= A224), R227 (= R225), D251 (= D249), H275 (= H273), A278 (= A276), Y312 (= Y310)
5tsdA Crystal structure of NADPH-dependent 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADPH and oxalate
34% identity, 81% coverage: 59:310/310 of query aligns to 61:316/316 of 5tsdA
- active site: E260 (= E254), H279 (= H273)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A71 (= A69), R89 (= R87), M99 (= M97), G143 (= G141), L144 (≠ T142), G145 (= G143), I146 (≠ Q144), L147 (≠ M145), W165 (= W163), S166 (≠ N164), R167 (≠ L165), T168 (≠ R166), K170 (≠ G168), L197 (= L196), P198 (= P197), A229 (≠ L223), G230 (≠ A224), R231 (= R225), D255 (= D249), H279 (= H273), Y316 (= Y310)
- binding oxalic acid: G70 (≠ W68), A71 (= A69), G72 (= G70), R231 (= R225), H279 (= H273)
Sites not aligning to the query:
5bqfA Probable 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADP, hepes and l(+)-tartaric acid
34% identity, 81% coverage: 59:310/310 of query aligns to 62:317/317 of 5bqfA
- active site: E261 (= E254), H280 (= H273)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A72 (= A69), R90 (= R87), M100 (= M97), G144 (= G141), L145 (≠ T142), G146 (= G143), I147 (≠ Q144), L148 (≠ M145), W166 (= W163), S167 (≠ N164), R168 (≠ L165), T169 (≠ R166), L198 (= L196), P199 (= P197), A230 (≠ L223), G231 (≠ A224), R232 (= R225), H280 (= H273), A283 (= A276), Y317 (= Y310)
4xcvA Probable 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADPH
34% identity, 81% coverage: 59:310/310 of query aligns to 62:317/317 of 4xcvA
- active site: E261 (= E254), H280 (= H273)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A72 (= A69), R90 (= R87), M100 (= M97), G144 (= G141), L145 (≠ T142), G146 (= G143), I147 (≠ Q144), L148 (≠ M145), W166 (= W163), S167 (≠ N164), R168 (≠ L165), T169 (≠ R166), K171 (≠ G168), L198 (= L196), P199 (= P197), A230 (≠ L223), G231 (≠ A224), R232 (= R225), H280 (= H273), A283 (= A276), Y317 (= Y310)
5mh6A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-ketohexanoic acid and NAD+ (1.35 a resolution)
33% identity, 67% coverage: 97:304/310 of query aligns to 93:305/306 of 5mh6A
- binding 2-Ketohexanoic acid: R224 (= R225), H272 (= H273), Y280 (vs. gap)
- binding magnesium ion: T130 (vs. gap), A132 (= A132), F210 (= F211), E211 (≠ N212), M213 (≠ L214), G225 (= G226), P226 (≠ G227), V228 (= V229), E230 (= E231), D241 (≠ Q242), S251 (≠ R252)
- binding nicotinamide-adenine-dinucleotide: G142 (= G143), T143 (≠ Q144), L144 (≠ M145), R164 (≠ L165), P196 (= P197), T201 (= T202), V222 (≠ L223), A223 (= A224), R224 (= R225), H272 (= H273), S274 (≠ A275)
Sites not aligning to the query:
5mhaB D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
33% identity, 67% coverage: 97:304/310 of query aligns to 95:307/308 of 5mhaB
- binding 2-Ketohexanoic acid: R226 (= R225), H274 (= H273), Y282 (vs. gap)
- binding (2R)-2-hydroxyhexanoic acid: Y282 (vs. gap)
- binding magnesium ion: F212 (= F211), E213 (≠ N212), M215 (≠ L214), D243 (≠ Q242)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L143 (≠ T142), G144 (= G143), T145 (≠ Q144), L146 (≠ M145), R165 (≠ N164), R166 (≠ L165), S167 (≠ R166), P180 (≠ M179), T197 (≠ L196), P198 (= P197), T203 (= T202), V224 (≠ L223), A225 (= A224), R226 (= R225), H274 (= H273), S276 (≠ A275)
Sites not aligning to the query:
5mhaA D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
33% identity, 67% coverage: 97:304/310 of query aligns to 95:307/308 of 5mhaA
- binding 2-Ketohexanoic acid: R226 (= R225), H274 (= H273), Y282 (vs. gap)
- binding magnesium ion: T132 (vs. gap), A134 (= A132)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L143 (≠ T142), G144 (= G143), T145 (≠ Q144), L146 (≠ M145), R165 (≠ N164), R166 (≠ L165), S167 (≠ R166), P180 (≠ M179), T197 (≠ L196), P198 (= P197), T203 (= T202), V224 (≠ L223), A225 (= A224), R226 (= R225), H274 (= H273), S276 (≠ A275)
Sites not aligning to the query:
5mh5A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-keto-hexanoic acid and NADP+ (1.4 a resolution)
33% identity, 67% coverage: 97:304/310 of query aligns to 95:307/308 of 5mh5A
- binding 2-Ketohexanoic acid: R226 (= R225), H274 (= H273), Y282 (vs. gap)
- binding magnesium ion: T132 (vs. gap), A134 (= A132), F212 (= F211), E213 (≠ N212), M215 (≠ L214), D243 (≠ Q242)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G142 (= G141), L143 (≠ T142), G144 (= G143), T145 (≠ Q144), L146 (≠ M145), R165 (≠ N164), R166 (≠ L165), S167 (≠ R166), T197 (≠ L196), P198 (= P197), T203 (= T202), V224 (≠ L223), A225 (= A224), R226 (= R225), H274 (= H273), S276 (≠ A275)
Sites not aligning to the query:
3bazA Structure of hydroxyphenylpyruvate reductase from coleus blumei in complex with NADP+ (see paper)
29% identity, 83% coverage: 45:300/310 of query aligns to 46:306/311 of 3bazA
- active site: L98 (≠ M93), R230 (= R225), A251 (= A246), D254 (= D249), E259 (= E254), H277 (= H273)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V74 (≠ A69), G149 (= G141), L150 (≠ T142), G151 (= G143), R152 (≠ Q144), I153 (≠ M145), S172 (vs. gap), R173 (vs. gap), S174 (vs. gap), C201 (≠ L196), P202 (= P197), T207 (= T202), I228 (≠ L223), G229 (≠ A224), R230 (= R225), D254 (= D249), H277 (= H273), G279 (≠ A275)
Q65CJ7 Hydroxyphenylpyruvate reductase; HPPR; EC 1.1.1.237 from Plectranthus scutellarioides (Coleus) (Solenostemon scutellarioides) (see paper)
29% identity, 83% coverage: 45:300/310 of query aligns to 48:308/313 of Q65CJ7
- LGRI 152:155 (≠ TGQM 142:145) binding
- SRS 174:176 (vs. gap) binding
- I230 (≠ L223) binding
- D256 (= D249) binding
Q9UBQ7 Glyoxylate reductase/hydroxypyruvate reductase; EC 1.1.1.79; EC 1.1.1.81 from Homo sapiens (Human) (see paper)
29% identity, 78% coverage: 60:300/310 of query aligns to 74:322/328 of Q9UBQ7
2gcgA Ternary crystal structure of human glyoxylate reductase/hydroxypyruvate reductase (see paper)
29% identity, 78% coverage: 60:300/310 of query aligns to 70:318/324 of 2gcgA
- active site: L103 (≠ M93), R241 (= R225), D265 (= D249), E270 (= E254), H289 (= H273)
- binding (2r)-2,3-dihydroxypropanoic acid: S78 (≠ W68), V79 (≠ A69), G80 (= G70), R241 (= R225), H289 (= H273)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V79 (≠ A69), T107 (≠ M97), G156 (= G141), G158 (= G143), I160 (≠ M145), G180 (= G162), R181 (≠ W163), R184 (= R166), C212 (≠ L196), S213 (≠ P197), T218 (= T202), I239 (≠ L223), R241 (= R225), D265 (= D249), H289 (= H273), G291 (≠ A275)
Sites not aligning to the query:
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
35% identity, 49% coverage: 139:289/310 of query aligns to 146:298/305 of 6plfA
Query Sequence
>GFF2734 FitnessBrowser__psRCH2:GFF2734
MDILLSGSFDDDERDAWLAELQAALPDARWHVTATPENAGLITAAVVANPPPGSLQGLPN
LRLIQSLWAGVDRLLNDPSLPDVPVARMVDPAMSAAMAETALWATLSLHRHFYAFARQQH
AREWQPLPQRRADEIQVTLLGTGQMGRACAMRLLALGYRVTGWNLRGGTLEGLPLEHGMD
ALWPLLARSDIVLNLLPLTAQTSDLLDRRFFNALRPGAGLVNLARGGHVVETDLLQALAS
AQVSHAVLDVFRNEPLPPEHPFWSHPQVTVLPHVAAATDMRSAARIVVQNLRALRDGQPL
RDLVERSRGY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory