SitesBLAST
Comparing GFF2746 FitnessBrowser__Phaeo:GFF2746 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8fdbB Crystal structure of nagb-ii phosphosugar isomerase from shewanella denitrificans os217 in complex with glucitolamine-6-phosphate at 3.06 a resolution. (see paper)
37% identity, 100% coverage: 1:342/342 of query aligns to 1:333/333 of 8fdbB
- binding 2-deoxy-2-amino glucitol-6-phosphate: R49 (= R49), R49 (= R49), G50 (= G50), S51 (= S51), S52 (= S52), Y61 (= Y61), A75 (≠ G75), P76 (= P76), S77 (= S77), S97 (= S97), Q98 (= Q98), S99 (= S99), R211 (= R211), Y215 (≠ L215), K224 (= K224), E227 (= E227), S237 (= S237)
8fdbA Crystal structure of nagb-ii phosphosugar isomerase from shewanella denitrificans os217 in complex with glucitolamine-6-phosphate at 3.06 a resolution. (see paper)
36% identity, 100% coverage: 2:342/342 of query aligns to 1:332/332 of 8fdbA
- binding 2-deoxy-2-amino glucitol-6-phosphate: R48 (= R49), R48 (= R49), G49 (= G50), S50 (= S51), S51 (= S52), D52 (= D53), Y60 (= Y61), A74 (≠ G75), P75 (= P76), S76 (= S77), S96 (= S97), Q97 (= Q98), S98 (= S99), V147 (= V148), A148 (= A149), A149 (= A150), R210 (= R211), Y214 (≠ L215), K223 (= K224), E226 (= E227), S236 (= S237)
- binding magnesium ion: G47 (≠ A48), R48 (= R49), Y60 (= Y61), I95 (≠ V96), S96 (= S97), R210 (= R211), Y214 (≠ L215)
8eymA Crystal structure of nagb-ii phosphosugar isomerase from shewanella denitrificans os217 in complex with glucitolamine-6-phosphate and n- acetylglucosamine-6-phosphate at 2.31 a resolution (see paper)
36% identity, 95% coverage: 5:330/342 of query aligns to 3:319/319 of 8eymA
- binding 2-acetamido-2-deoxy-6-O-phosphono-alpha-D-glucopyranose: R47 (= R49), D51 (= D53), Y59 (= Y61), A71 (≠ S73), A72 (≠ V74), P74 (= P76), S75 (= S77), R209 (= R211), S235 (= S237), E238 (= E240)
- binding 2-deoxy-2-amino glucitol-6-phosphate: G48 (= G50), S49 (= S51), S95 (= S97), Q96 (= Q98), A147 (= A149), A148 (= A150), K222 (= K224), E225 (= E227)
P14742 Glutamine--fructose-6-phosphate aminotransferase [isomerizing]; GFAT; D-fructose-6-phosphate amidotransferase; Hexosephosphate aminotransferase; EC 2.6.1.16 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
25% identity, 97% coverage: 7:337/342 of query aligns to 356:712/717 of P14742
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 active site, For GATase activity
1morA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucose 6-phosphate (see paper)
28% identity, 97% coverage: 7:337/342 of query aligns to 10:361/366 of 1morA
- active site: E239 (= E220), K243 (= K224), E246 (= E227), H262 (= H243), K361 (= K337)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (≠ S51), S105 (= S97), Q106 (= Q98), S107 (= S99), T110 (≠ S102), V157 (= V148), A360 (≠ K336), K361 (= K337)
1moqA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucosamine 6-phosphate (see paper)
28% identity, 97% coverage: 7:337/342 of query aligns to 10:361/366 of 1moqA
- active site: E239 (= E220), K243 (= K224), E246 (= E227), H262 (= H243), K361 (= K337)
- binding 2-amino-2-deoxy-6-O-phosphono-alpha-D-glucopyranose: T60 (≠ S51), S61 (= S52), S105 (= S97), Q106 (= Q98), S107 (= S99), T110 (≠ S102), V157 (= V148), A360 (≠ K336), K361 (= K337)
1mosA Isomerase domain of glucosamine 6-phosphate synthase complexed with 2- amino-2-deoxyglucitol 6-phosphate (see paper)
28% identity, 97% coverage: 7:337/342 of query aligns to 11:362/367 of 1mosA
- active site: E240 (= E220), K244 (= K224), E247 (= E227), H263 (= H243), K362 (= K337)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T61 (≠ S51), S62 (= S52), S106 (= S97), Q107 (= Q98), S108 (= S99), T111 (≠ S102), K244 (= K224), E247 (= E227)
2j6hA E. Coli glucosamine-6-p synthase in complex with glucose-6p and 5-oxo- l-norleucine (see paper)
28% identity, 97% coverage: 7:337/342 of query aligns to 252:603/608 of 2j6hA
- active site: E481 (= E220), K485 (= K224), E488 (= E227), H504 (= H243), K603 (= K337)
- binding glucose-6-phosphate: T302 (≠ S51), S347 (= S97), Q348 (= Q98), S349 (= S99), T352 (≠ S102), V399 (= V148), S401 (≠ A150), E488 (= E227)
Sites not aligning to the query:
- active site: 1, 26, 27, 74, 98, 99, 248
- binding 5-oxo-l-norleucine: 1, 73, 74, 76, 86, 98, 99, 123
4amvA E.Coli glucosamine-6p synthase in complex with fructose-6p (see paper)
27% identity, 97% coverage: 7:337/342 of query aligns to 252:603/608 of 4amvA
- active site: E481 (= E220), K485 (= K224), E488 (= E227), H504 (= H243), K603 (= K337)
- binding fructose -6-phosphate: G301 (= G50), T302 (≠ S51), S303 (= S52), S347 (= S97), Q348 (= Q98), S349 (= S99), T352 (≠ S102), S401 (≠ A150), K485 (= K224), E488 (= E227)
Sites not aligning to the query:
1jxaA Glucosamine 6-phosphate synthase with glucose 6-phosphate (see paper)
27% identity, 97% coverage: 7:337/342 of query aligns to 252:603/608 of 1jxaA
- active site: E481 (= E220), K485 (= K224), E488 (= E227), H504 (= H243), K603 (= K337)
- binding glucose-6-phosphate: T302 (≠ S51), S303 (= S52), S347 (= S97), Q348 (= Q98), S349 (= S99), T352 (≠ S102), S401 (≠ A150), K485 (= K224), E488 (= E227)
Sites not aligning to the query:
7dnrA Crystal structure of zn-bound sis domain of glucosamine-6-p synthase from e. Coli
27% identity, 96% coverage: 7:333/342 of query aligns to 10:357/357 of 7dnrA
2pocB The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
24% identity, 95% coverage: 7:330/342 of query aligns to 6:352/352 of 2pocB
- active site: E236 (= E220), K240 (= K224), E243 (= E227), H259 (= H243)
- binding 6-O-phosphono-beta-D-glucopyranose: C55 (≠ R49), T57 (≠ S51), S58 (= S52), S102 (= S97), Q103 (= Q98), S104 (= S99), T107 (≠ S102), E243 (= E227)
- binding uridine-diphosphate-n-acetylglucosamine: R24 (= R26), G36 (≠ A38), G126 (≠ A121), V128 (≠ T123), S136 (≠ A131), T139 (≠ A134), C141 (≠ H136), G142 (≠ T137), V143 (≠ L138), H144 (≠ D139)
2zj4A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
25% identity, 97% coverage: 7:337/342 of query aligns to 9:360/365 of 2zj4A
- active site: E238 (= E220), K242 (= K224), E245 (= E227), H261 (= H243), K360 (= K337)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T60 (≠ S51), S61 (= S52), S105 (= S97), Q106 (= Q98), S107 (= S99), T110 (≠ S102), V156 (= V148), A157 (= A149), K242 (= K224), E245 (= E227)
2zj3A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
25% identity, 97% coverage: 7:337/342 of query aligns to 9:360/365 of 2zj3A
- active site: E238 (= E220), K242 (= K224), E245 (= E227), H261 (= H243), K360 (= K337)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (≠ S51), S61 (= S52), S105 (= S97), Q106 (= Q98), S107 (= S99), T110 (≠ S102), V156 (= V148), A359 (≠ K336), K360 (= K337)
6svmA Crystal structure of human gfat-1 in complex with glucose-6-phosphate, l-glu, and udp-galnac (see paper)
25% identity, 97% coverage: 7:337/342 of query aligns to 304:655/660 of 6svmA
- active site: E533 (= E220), K537 (= K224), E540 (= E227), H556 (= H243), K655 (= K337)
- binding glucose-6-phosphate: C353 (≠ R49), T355 (≠ S51), S356 (= S52), S400 (= S97), Q401 (= Q98), S402 (= S99), T405 (≠ S102), S453 (≠ A150), K537 (= K224), E540 (= E227)
- binding magnesium ion: S434 (≠ A131), R435 (≠ A132), T437 (≠ A134)
- binding uridine-diphosphate-n-acetylgalactosamine: R322 (= R26), G334 (≠ A38), G424 (≠ A121), T426 (= T123), S434 (≠ A131), T437 (≠ A134), C439 (≠ H136), G440 (≠ T137), V441 (≠ L138), H442 (≠ D139)
Sites not aligning to the query:
- active site: 7, 32, 95, 122, 123
- binding glutamic acid: 1, 94, 95, 97, 107, 123, 147
- binding uridine-diphosphate-n-acetylgalactosamine: 289
6r4eA Crystal structure of human gfat-1 in complex with glucose-6-phosphate and l-glu (see paper)
25% identity, 97% coverage: 7:337/342 of query aligns to 307:658/663 of 6r4eA
- active site: E536 (= E220), K540 (= K224), E543 (= E227), H559 (= H243), K658 (= K337)
- binding glucose-6-phosphate: T358 (≠ S51), S359 (= S52), S403 (= S97), Q404 (= Q98), S405 (= S99), T408 (≠ S102), S456 (≠ A150), K540 (= K224), E543 (= E227)
Sites not aligning to the query:
Q06210 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1; D-fructose-6-phosphate amidotransferase 1; Glutamine:fructose-6-phosphate amidotransferase 1; GFAT 1; GFAT1; Hexosephosphate aminotransferase 1; EC 2.6.1.16 from Homo sapiens (Human) (see paper)
25% identity, 97% coverage: 7:337/342 of query aligns to 343:694/699 of Q06210
6r4gA Crystal structure of human gfat-1 in complex with udp-glcnac (see paper)
25% identity, 96% coverage: 7:335/342 of query aligns to 303:652/652 of 6r4gA
- active site: E532 (= E220), K536 (= K224), E539 (= E227), H555 (= H243)
- binding glucose-6-phosphate: G353 (= G50), T354 (≠ S51), S355 (= S52), S399 (= S97), Q400 (= Q98), S401 (= S99), T404 (≠ S102), S452 (≠ A150), E539 (= E227)
- binding magnesium ion: S433 (≠ A131), R434 (≠ A132), T436 (≠ A134)
- binding uridine-diphosphate-n-acetylglucosamine: R321 (= R26), G333 (≠ A38), G423 (≠ A121), T425 (= T123), S433 (≠ A131), T436 (≠ A134), C438 (≠ H136), G439 (≠ T137), V440 (≠ L138), H441 (≠ D139)
Sites not aligning to the query:
2v4mA The isomerase domain of human glutamine-fructose-6-phosphate transaminase 1 (gfpt1) in complex with fructose 6-phosphate
24% identity, 82% coverage: 7:288/342 of query aligns to 8:305/352 of 2v4mA
- active site: E237 (= E220), K241 (= K224), E244 (= E227), H260 (= H243)
- binding fructose -6-phosphate: T59 (≠ S51), S60 (= S52), S104 (= S97), Q105 (= Q98), S106 (= S99), T109 (≠ S102), A156 (= A149), S157 (≠ A150), K241 (= K224), E244 (= E227)
2puwB The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
24% identity, 95% coverage: 7:330/342 of query aligns to 6:331/331 of 2puwB
Query Sequence
>GFF2746 FitnessBrowser__Phaeo:GFF2746
MTDITKMRREIDEIPTAVDRLLSHGRVEIEAVADAARALDPNVMVTVARGSSDHVCTYLK
YASEIMLGVPVASVGPSVASIYKAPLRLKGALSLAVSQSGKSPDIVSMAGSARKDGALSV
ALTNDAASPLAAAADHTLDIHAGPELSVAATKTFVTSAVAGLWLLAQWDRNQAVLAALHA
LPEQLDRACRIDWPEVRDAIGARSSLFTLGRGQALAVSNEAALKFKETCQLHAESYSSAE
VLHGPVSIVEEGFPVLGFAAADAAEGALAGIADQIAAKGAQVFATTDKVTAARRVDHVRT
DHALTDPISLIVSFYAMVEAFAASRGIDPDAPRHLKKVTETV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory