Comparing GFF2748 FitnessBrowser__Phaeo:GFF2748 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
2e2oA Crystal structure of sulfolobus tokodaii hexokinase in complex with glucose (see paper)
28% identity, 60% coverage: 79:257/300 of query aligns to 68:249/299 of 2e2oA
2e2qA Crystal structure of sulfolobus tokodaii hexokinase in complex with xylose, mg2+, and adp (see paper)
28% identity, 60% coverage: 79:257/300 of query aligns to 68:249/297 of 2e2qA
Sites not aligning to the query:
2e2pA Crystal structure of sulfolobus tokodaii hexokinase in complex with adp (see paper)
28% identity, 60% coverage: 79:257/300 of query aligns to 68:249/298 of 2e2pA
Sites not aligning to the query:
>GFF2748 FitnessBrowser__Phaeo:GFF2748
MTDSRFPYLIAVDGGGTSCRFALLKSGATPPQQLVVTGGSANVYTAPDQAVETLSAGLAD
LQRQSGLTDEVFHQIPVYAGLAGVIDGESAARVAEALPQAHVRVEDDRMPAVVGALGEDT
ASLIGVGTGSFLGRQVAGQVTLIGGHGTVLGDEASGGWLGRRALQLTLQAAEGIEPMTPL
LRSCLRDFSNETAKIVRFAQTARPVAFGAYAPRVAKAAVEGDAAGRRLMAEGAEYLCNGL
QALGRRPEEPVYHIGGVAAQYAAYLPADVADYLRGAEGSPLDGALELARRFAREIAQEVV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory