Comparing GFF2751 FitnessBrowser__Marino:GFF2751 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6pccA Crystal structure of beta-ketoadipyl-coa thiolase mutant (h356a) in complex hexanoyl coenzyme a (see paper)
64% identity, 98% coverage: 7:411/415 of query aligns to 4:403/403 of 6pccA
6pcbA Crystal structure of beta-ketoadipyl-coa thiolase mutant (h356a) in complex with coa (see paper)
64% identity, 98% coverage: 7:411/415 of query aligns to 4:403/403 of 6pcbA
6pcdA Crystal structure of beta-ketoadipyl-coa thiolase mutant (c90s-h356a) in complex octanoyl coenzyme a (see paper)
64% identity, 98% coverage: 7:411/415 of query aligns to 5:401/401 of 6pcdA
P45359 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; CaTHL; EC 2.3.1.9 from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) (see paper)
44% identity, 97% coverage: 7:410/415 of query aligns to 1:391/392 of P45359
P14611 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
44% identity, 97% coverage: 7:410/415 of query aligns to 1:392/393 of P14611
4xl4A Crystal structure of thiolase from clostridium acetobutylicum in complex with coa (see paper)
44% identity, 97% coverage: 7:410/415 of query aligns to 1:391/392 of 4xl4A
5f38D X-ray crystal structure of a thiolase from escherichia coli at 1.8 a resolution (see paper)
46% identity, 97% coverage: 7:410/415 of query aligns to 3:394/394 of 5f38D
4o9cC Crystal structure of beta-ketothiolase (phaa) from ralstonia eutropha h16 (see paper)
44% identity, 97% coverage: 7:410/415 of query aligns to 1:392/393 of 4o9cC
5f38B X-ray crystal structure of a thiolase from escherichia coli at 1.8 a resolution (see paper)
46% identity, 98% coverage: 7:411/415 of query aligns to 1:391/391 of 5f38B
5bz4K Crystal structure of a t1-like thiolase (coa-complex) from mycobacterium smegmatis (see paper)
44% identity, 98% coverage: 8:412/415 of query aligns to 1:399/400 of 5bz4K
8oqlC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1
43% identity, 97% coverage: 8:411/415 of query aligns to 2:397/397 of 8oqlC
8oqmD Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-10
43% identity, 97% coverage: 8:411/415 of query aligns to 3:399/399 of 8oqmD
8oqoC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49
43% identity, 97% coverage: 8:411/415 of query aligns to 2:398/398 of 8oqoC
P42765 3-ketoacyl-CoA thiolase, mitochondrial; Acetyl-CoA acetyltransferase; Acetyl-CoA acyltransferase; Acyl-CoA hydrolase, mitochondrial; Beta-ketothiolase; Mitochondrial 3-oxoacyl-CoA thiolase; T1; EC 2.3.1.16; EC 2.3.1.9; EC 3.1.2.-; EC 3.1.2.1; EC 3.1.2.2 from Homo sapiens (Human) (see paper)
42% identity, 97% coverage: 6:409/415 of query aligns to 3:394/397 of P42765
8opyD Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-b-dnq
43% identity, 97% coverage: 8:411/415 of query aligns to 3:401/401 of 8opyD
7o4tD Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme with coenzyme a bound at the hydratase, thiolase active sites and possible additional binding site (coa(ech/had)) (see paper)
42% identity, 97% coverage: 8:411/415 of query aligns to 3:403/403 of 7o4tD
O53871 Putative acyltransferase Rv0859; EC 2.3.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
42% identity, 97% coverage: 8:411/415 of query aligns to 3:403/403 of O53871
8pf8C Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
42% identity, 97% coverage: 8:411/415 of query aligns to 2:402/402 of 8pf8C
8oqsC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-83
42% identity, 97% coverage: 8:411/415 of query aligns to 2:402/402 of 8oqsC
8oqpC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-76
42% identity, 97% coverage: 8:411/415 of query aligns to 2:402/402 of 8oqpC
>GFF2751 FitnessBrowser__Marino:GFF2751
MSADNILKDAYIVDAIRTPIGRYGGALSAVRADDLGAIPIKALAERYPDLDWSKIDDVLY
GCANQAGEDNRDVARMSLLLAGLPVDVPGSTINRLCGSGMDAVGSAARAIRTGETQLMIA
GGVESMSRAPFVMGKADSAFSRKAEIFDTTIGWRFVNPVLKKQYGIDSMPETAENVAADF
GISREDQDAFALRSQQRTAAAQKEGRLAAEITPVTIPRRKQDPLVVDTDEHPRETSLEKL
ASLPTPFRENGTVTAGNASGVNDGACALLLAGADALKQYNLKPRARVVAMATAGVEPRIM
GFGPAPATRKVLATAGLELADMDVIELNEAFAAQALAVTRDLGLPDDAEHVNPNGGAIAL
GHPLGMSGARLVTTALNELERRHAAGQKARYALCTMCIGVGQGIALIIERMDAVA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory