Comparing GFF2751 FitnessBrowser__Phaeo:GFF2751 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
27% identity, 73% coverage: 16:240/308 of query aligns to 34:252/313 of P94529
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
28% identity, 94% coverage: 6:296/308 of query aligns to 3:276/285 of 7cagA
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
28% identity, 73% coverage: 80:304/308 of query aligns to 287:512/514 of P02916
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
29% identity, 68% coverage: 80:288/308 of query aligns to 272:483/490 of 4ki0F
>GFF2751 FitnessBrowser__Phaeo:GFF2751
MQNTPHKPRRRWHIAVFLAPAVLVYTAIMIFPLFNTLRLALYSESDQIRQFVGLANFETL
FGNPNWSEQFWNALGNNFWFFFVHMLVQNPIGVALAAILSHPRLRFAALYRTAIFVPTIL
SFVIVGFAWKLILSPIWGITPDLLDAIGLKWLFAPWLGKEDYALTTLALISVWQFVGIPM
MLIYAALLSIPEEVIEAGEVDGITGMSAFWKIKLPLILPSIGIISILTFVGNFNAFDLIY
TTQGALAGPDFSTDILGTFMYRTFFGFQLQLGDPHMGSAIATAMFAIILIGVCIYLFGIQ
TRLRRYQF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory