SitesBLAST – Find functional sites

 

SitesBLAST

Comparing GFF2751 FitnessBrowser__Phaeo:GFF2751 to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found 4 hits to proteins with known functional sites (download)

P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
27% identity, 73% coverage: 16:240/308 of query aligns to 34:252/313 of P94529

query
sites
P94529
V
 
L
F
 
F
L
 
T
A
 
A
P
 
P
A
 
F
V
 
V
L
 
L
V
 
S
Y
 
F
T
 
L
A
 
V
I
 
F
M
 
F
I
 
L
F
 
Y
P
 
P
L
 
I
F
 
I
N
 
S
T
 
V
L
 
F
R
 
I
L
 
M
A
 
S
L
 
F
Y
 
Q
S
 
R
E
 
I
S
 
L
D
 
P
Q
 
G
I
 
E
R
 
V
Q
 
S
F
 
F
V
 
V
G
 
G
L
 
L
A
 
S
N
 
N
F
 
Y
E
 
T
T
 
A
L
 
L
F
 
-
G
 
N
N
 
N
P
 
P
N
 
T
W
 
F
S
 
Y
E
 
T
Q
 
A
F
 
L
W
 
W
N
 
N
A
 
T
L
 
L
G
 
E
N
 
Y
N
 
T
F
 
F
W
 
W
F
 
-
F
 
-
F
 
-
V
 
-
H
 
T
M
 
L
L
 
I
V
 
V
Q
 
L
N
 
I
P
 
P
I
 
V
G
 
P
V
 
L
A
 
L
L
 
L
A
 
A
A
 
I
I
 
F
L
 
L
S
 
N
H
 
S
P
 
K
R
 
L
L
 
V
R
 
K
F
 
F
A
 
R
A
 
N
L
 
I
Y
 
F
R
 
K
T
 
S
A
 
A
I
 
L
F
 
F
V
 
I
P
 
P
T
 
A
I
 
L
L
 
T
S
 
S
F
 
T
V
 
I
I
 
V
V
 
A
G
 
G
F
 
I
A
 
I
W
 
F
K
 
R
L
 
L
I
 
I
L
 
F
S
 
G
P
 
E
I
 
M
W
 
-
G
 
-
I
 
-
T
 
E
P
 
T
D
 
S
L
 
L
L
 
A
D
 
N
A
 
S
I
 
I
G
 
L
L
 
L
K
 
K
W
 
L
L
 
G
F
 
F
A
 
S
P
 
P
-
 
Q
-
 
N
W
 
W
L
 
M
G
 
N
K
 
N
E
 
E
D
 
H
Y
 
T
A
 
G
L
 
M
T
 
F
T
 
L
L
 
M
A
 
V
L
 
L
I
 
L
S
 
A
V
 
S
W
 
W
Q
 
R
F
 
W
V
 
M
G
 
G
I
 
I
P
 
N
M
 
I
M
 
L
L
 
Y
I
 
F
Y
 
L
A
 
A
A
 
G
L
 
L
L
 
Q
S
 
N
I
 
V
P
 
P
E
 
K
E
|
E
V
 
L
I
 
Y
E
|
E
A
 
A
G
 
A
E
 
D
V
 
I
D
|
D
G
 
G
I
 
A
T
 
N
G
 
T
M
 
M
S
 
K
A
 
K
F
 
F
W
 
L
K
 
H
I
 
I
K
 
T
L
 
L
P
 
P
L
 
F
I
 
L
L
 
K
P
 
P
S
 
V
I
 
T
G
 
V
I
 
Y
I
 
V
S
 
L
I
 
T
L
 
I
T
 
S
F
 
I
V
 
I
G
 
G
N
 
G
F
 
F
N
 
R
A
 
M
F
 
F
D
 
E
L
 
E
I
 
S
Y
 
Y

7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
28% identity, 94% coverage: 6:296/308 of query aligns to 3:276/285 of 7cagA

query
sites
7cagA
H
 
K
K
 
K
P
 
S
R
 
E
R
 
R
R
 
R
-
 
L
-
 
A
-
 
F
W
 
W
H
 
L
I
 
I
A
 
A
V
 
-
F
 
-
L
 
-
A
 
-
P
 
P
A
 
A
V
 
V
L
 
L
V
 
L
Y
 
M
T
 
L
A
 
A
I
 
V
M
 
T
I
 
A
F
 
Y
P
 
P
L
 
I
F
 
G
N
 
Y
T
 
A
L
 
V
R
 
W
L
 
L
A
 
S
L
 
L
-
 
Q
-
 
R
Y
 
Y
S
 
N
E
 
L
S
 
A
D
 
E
-
 
P
Q
 
H
I
 
D
R
 
T
Q
 
E
F
 
F
V
 
I
G
 
G
L
 
L
A
 
A
N
 
N
F
 
Y
E
 
V
T
 
T
L
 
V
F
 
L
G
 
T
N
 
D
P
 
G
N
 
Y
W
 
W
S
 
-
E
 
-
Q
 
-
F
 
-
W
 
W
N
 
T
A
 
A
L
 
F
G
 
A
N
 
V
N
 
T
F
 
L
W
 
G
F
 
I
F
 
T
F
 
V
V
 
V
H
 
S
M
 
V
L
 
A
V
 
I
Q
 
E
N
 
F
P
 
A
I
 
L
G
 
G
V
 
L
A
 
A
L
 
L
A
 
A
A
 
L
I
 
V
L
 
M
S
 
-
H
 
H
P
 
R
R
 
T
L
 
I
R
 
F
F
 
G
A
 
K
A
 
G
L
 
A
Y
 
V
R
 
R
T
 
T
A
 
A
I
 
I
F
 
L
V
 
I
P
 
P
T
 
Y
I
 
G
L
 
I
S
 
V
F
 
T
V
 
V
I
 
A
V
 
A
G
 
S
F
 
Y
A
 
S
W
 
W
K
 
Y
L
 
Y
I
 
A
L
 
W
S
 
T
P
 
P
I
 
G
W
 
T
G
 
G
I
 
Y
T
 
L
P
 
A
D
 
N
L
 
L
L
 
L
D
 
P
A
 
E
I
 
G
G
 
S
L
 
-
K
 
-
W
 
-
L
 
-
F
 
-
A
 
A
P
 
P
W
 
-
L
 
L
G
 
T
K
 
D
E
 
Q
D
 
L
Y
 
P
A
 
S
L
 
L
T
 
A
T
 
I
L
 
V
A
 
V
L
 
L
I
 
A
S
x
E
V
 
V
W
 
W
Q
x
K
F
 
T
V
 
T
G
 
P
I
 
F
P
 
M
M
 
A
M
 
L
L
 
L
I
 
L
Y
 
L
A
 
A
A
 
G
L
 
L
L
 
A
S
 
L
I
 
V
P
 
P
E
 
Q
E
 
D
V
 
L
I
 
L
E
 
N
A
 
A
G
 
A
E
 
Q
V
 
V
D
 
D
G
 
G
I
 
A
T
 
G
G
 
P
M
 
W
S
 
K
A
 
R
F
 
L
W
 
T
K
 
K
I
 
V
K
 
I
L
 
L
P
 
P
L
 
M
I
 
I
L
 
K
P
 
P
S
 
A
I
 
I
G
 
L
I
 
V
I
 
A
S
 
L
I
 
L
L
 
F
T
x
R
F
 
T
V
 
L
G
x
D
N
 
A
F
 
F
N
x
R
A
 
I
F
 
F
D
 
D
L
 
N
I
 
I
Y
 
Y
T
 
I
T
 
L
Q
 
T
G
 
G
A
 
G
L
 
-
A
 
S
G
 
N
P
 
D
D
 
T
F
 
G
S
 
S
T
 
V
D
 
S
I
 
I
L
 
L
G
 
G
T
 
-
F
 
-
M
 
-
Y
 
Y
R
 
D
T
 
N
F
 
L
F
 
F
G
 
-
F
 
-
Q
 
-
L
 
-
Q
 
K
L
 
A
G
 
F
D
 
N
P
 
V
H
 
G
M
 
L
G
 
G
S
 
S
A
 
A
I
 
I
A
 
S
T
 
V
A
 
L
M
 
I
F
 
F
A
 
L
I
 
S
I
 
V
L
 
A
I
 
I
G
 
I
V
 
A
C
 
F
I
 
I
Y
 
Y
L
 
I

P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
28% identity, 73% coverage: 80:304/308 of query aligns to 287:512/514 of P02916

query
sites
P02916
F
 
F
F
 
S
F
 
L
V
 
I
H
 
T
M
 
V
L
 
F
V
 
L
Q
 
T
N
 
V
P
 
A
I
 
V
G
 
G
V
 
M
A
 
V
L
 
L
A
 
A
A
 
C
I
 
L
L
 
V
S
 
Q
H
 
W
P
 
E
R
 
A
L
 
L
R
 
R
F
 
G
A
 
K
A
 
A
L
 
V
Y
 
Y
R
 
R
T
 
V
A
 
L
I
 
L
F
 
I
V
 
L
P
 
P
T
 
Y
I
 
A
L
 
V
S
 
P
F
 
S
V
 
F
I
 
I
V
 
S
G
 
I
F
x
L
A
 
I
W
 
F
K
 
K
L
 
G
I
 
L
L
 
F
S
 
N
P
 
Q
I
 
S
W
 
F
G
 
G
I
 
E
T
 
I
P
 
N
D
 
M
L
 
M
L
 
L
D
 
S
A
 
A
I
 
L
-
 
F
G
 
G
L
 
V
K
 
K
W
 
-
L
 
-
F
 
-
A
 
P
P
 
A
W
 
W
L
 
F
G
 
S
K
 
D
E
 
P
D
 
T
Y
 
T
A
 
A
L
 
R
T
 
T
T
 
M
L
|
L
A
 
I
L
 
I
I
 
V
S
x
N
V
 
T
W
 
W
Q
 
-
F
 
-
V
 
L
G
|
G
I
 
Y
P
 
P
M
 
Y
M
 
M
L
 
M
I
 
I
Y
 
L
A
 
C
A
 
M
-
 
G
-
 
L
L
 
L
L
 
K
S
 
A
I
 
I
P
 
P
E
 
D
E
 
D
V
 
L
I
 
Y
E
|
E
A
 
A
G
x
S
E
 
A
V
 
M
D
 
D
G
|
G
I
 
A
T
 
G
G
 
P
M
 
F
S
 
Q
A
 
N
F
 
F
W
 
F
K
 
K
I
 
I
K
 
T
L
 
L
P
|
P
L
 
L
I
 
L
L
 
I
P
 
K
S
 
P
I
 
L
G
 
T
I
 
P
I
 
L
S
 
M
I
 
I
L
 
A
T
 
S
F
 
F
V
 
A
G
 
F
N
 
N
F
 
F
N
 
N
A
 
N
F
 
F
D
 
V
L
 
L
I
 
I
Y
 
Q
-
 
L
T
 
L
T
 
T
Q
 
N
G
 
G
A
 
-
L
 
-
A
 
-
G
 
G
P
 
P
D
 
D
F
 
R
-
 
L
-
 
G
-
 
T
-
 
T
-
 
T
-
 
P
-
 
A
-
 
G
S
 
Y
T
 
T
D
 
D
I
 
L
L
 
L
G
 
V
T
 
N
F
 
Y
M
 
T
Y
 
Y
R
 
R
T
 
I
F
 
A
F
 
F
G
 
E
F
 
G
Q
 
G
L
 
-
Q
 
-
L
 
-
G
 
G
D
 
G
P
 
Q
H
 
D
M
 
F
G
 
G
S
 
L
A
 
A
I
 
A
A
 
A
T
 
I
A
 
A
M
 
T
F
 
L
A
 
I
I
 
F
I
 
L
L
 
L
I
 
V
G
 
G
V
 
A
C
 
L
I
 
A
Y
 
I
L
 
V
F
 
N
G
 
L
I
 
K
Q
 
A
T
 
T
R
 
R
L
 
M
R
 
K

4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
29% identity, 68% coverage: 80:288/308 of query aligns to 272:483/490 of 4ki0F

query
sites
4ki0F
F
 
F
F
 
S
F
 
L
V
 
I
H
x
T
M
 
V
L
 
F
V
 
L
Q
 
T
N
 
V
P
 
A
I
 
V
G
 
G
V
 
M
A
 
V
L
 
L
A
 
A
A
 
C
I
 
L
L
 
V
S
 
Q
H
 
W
P
 
E
R
 
A
L
 
L
R
 
R
F
 
G
A
 
K
A
 
A
L
 
V
Y
 
Y
R
 
R
T
 
V
A
 
L
I
 
L
F
 
I
V
 
L
P
 
P
T
x
Y
I
 
A
L
 
V
S
 
P
F
 
S
V
 
F
I
 
I
V
 
S
G
 
I
F
 
L
A
 
I
W
 
F
K
 
K
L
 
G
I
 
L
L
 
F
S
 
N
P
 
Q
I
 
S
W
 
F
G
 
G
I
 
E
T
 
I
P
 
N
D
 
M
L
 
M
L
 
L
D
 
S
A
 
A
I
 
L
-
 
F
G
 
G
L
 
V
K
 
K
W
 
-
L
 
-
F
 
-
A
 
P
P
 
A
W
 
W
L
 
F
G
 
S
K
 
D
E
 
P
D
 
T
Y
 
T
A
 
A
L
 
R
T
 
T
T
 
M
L
 
L
A
 
I
L
 
I
I
 
V
S
x
N
V
 
T
W
 
W
Q
 
-
F
 
-
V
x
L
G
|
G
I
 
Y
P
 
P
M
x
Y
M
 
M
L
 
M
I
 
I
Y
 
L
A
 
C
A
 
M
-
 
G
-
 
L
L
 
L
L
 
K
S
 
A
I
 
I
P
 
P
E
 
D
E
 
D
V
 
L
I
 
Y
E
 
E
A
 
A
G
 
S
E
 
A
V
 
M
D
 
D
G
 
G
I
 
A
T
 
G
G
 
P
M
 
F
S
 
Q
A
 
N
F
 
F
W
 
F
K
 
K
I
 
I
K
 
T
L
 
L
P
 
P
L
 
L
I
 
L
L
 
I
P
 
K
S
 
P
I
 
L
G
 
T
I
 
P
I
 
L
S
 
M
I
 
I
L
x
A
T
x
S
F
 
F
V
 
A
G
x
F
N
|
N
F
 
F
N
 
N
A
x
N
F
 
F
D
 
V
L
 
L
I
 
I
Y
 
Q
-
 
L
T
 
L
T
 
T
Q
 
N
G
 
G
A
 
-
L
 
-
A
 
-
G
 
G
P
 
P
D
 
D
F
 
R
-
 
L
-
 
G
-
 
T
-
 
T
-
 
T
-
 
P
-
 
A
-
 
G
S
 
Y
T
 
T
D
 
D
I
 
L
L
 
L
G
 
V
T
 
N
F
 
Y
M
 
T
Y
 
Y
R
 
R
T
 
I
F
 
A
F
 
F
-
 
E
-
 
G
-
 
G
G
 
G
F
 
G
Q
 
Q
L
 
-
Q
 
-
L
 
-
G
 
-
D
 
D
P
 
F
H
 
G
M
 
L
G
 
A
S
 
A
A
 
A
I
 
I
A
 
A
T
 
T
A
 
L
M
 
I
F
 
F
A
 
L
I
 
L
I
 
V

Query Sequence

>GFF2751 FitnessBrowser__Phaeo:GFF2751
MQNTPHKPRRRWHIAVFLAPAVLVYTAIMIFPLFNTLRLALYSESDQIRQFVGLANFETL
FGNPNWSEQFWNALGNNFWFFFVHMLVQNPIGVALAAILSHPRLRFAALYRTAIFVPTIL
SFVIVGFAWKLILSPIWGITPDLLDAIGLKWLFAPWLGKEDYALTTLALISVWQFVGIPM
MLIYAALLSIPEEVIEAGEVDGITGMSAFWKIKLPLILPSIGIISILTFVGNFNAFDLIY
TTQGALAGPDFSTDILGTFMYRTFFGFQLQLGDPHMGSAIATAMFAIILIGVCIYLFGIQ
TRLRRYQF

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory